SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trive1|34294|e_gw1.4.1691.1 from Trichoderma virens Gv29-8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trive1|34294|e_gw1.4.1691.1
Domain Number 1 Region: 23-185
Classification Level Classification E-value
Superfamily EF-hand 3.83e-20
Family Calmodulin-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Trive1|34294|e_gw1.4.1691.1
Sequence length 192
Sequence
KKQPPKRKSGGPSTASKPRQSKLAKEHNVTAQEEGEIKEAFSLFAEPMDGEKNGVLPIND
LKSTLIALGIPPSSPAELQEFIAILDPESDGYATYEPFFAICALKFHARDSSGSGSAAHR
EELAEAFQLFTNGADGPITLAHLRRVAAVLKEDVDEELLKDMILEANGGVGVARGVGLDE
FDSVMRSAGVWR
Download sequence
Identical sequences G9ME72
XP_013961568.1.71794 jgi|Trive1|34294|e_gw1.4.1691.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]