SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trive1|39603|e_gw1.8.415.1 from Trichoderma virens Gv29-8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trive1|39603|e_gw1.8.415.1
Domain Number 1 Region: 33-115
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000138
Family Calmodulin-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Trive1|39603|e_gw1.8.415.1
Sequence length 199
Sequence
MRAFLLCSAIAGVAIAHGSHSQKPIVDANANWMTKHMAEEHHVDGWDAASFFTLHDYDSD
GYWKGEELLRTYGLMDESNKHVSWERRDEILRGLLDLLDLNRDGIVSRDEWTDFTAQGKT
LPDMNTGPGHHGDDEYEYEIHHWEKYHDENTKLDDLNHPEDIEHFRKHEQMEEEEEQQEK
MDQMSIVEENIPKKFLKMS
Download sequence
Identical sequences G9NAT4
XP_013950151.1.71794 jgi|Trive1|39603|e_gw1.8.415.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]