SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trive1|45669|e_gw1.14.203.1 from Trichoderma virens Gv29-8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Trive1|45669|e_gw1.14.203.1
Domain Number - Region: 104-176
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0811
Family Myosin rod fragments 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Trive1|45669|e_gw1.14.203.1
Sequence length 282
Sequence
MSAKTPAQVLETLRRLQSNNELSIIKLSESISTSTPNDTLQRISDASNTSLDGPSPTSLD
ADLIHYKELFAKLRFSYVEQVTKEKFIRAIVGDPPLIVTLQENLDLERENAEAKAQLKNL
KLEVADLVSDLEKRGRELSRRYENIQLETVRLEELPAKIVELESRIKELKDQHESSESDP
NLRLPLTKTLSLVSKRKAEQQELARELEALQAKVPRKRKEAERLQAELQPLEAKRQSSTT
AAREARRRKEAALGGVADDLEQRARWWRASESMLKQVLDINT
Download sequence
Identical sequences G9MQ20
jgi|Trive1|45669|e_gw1.14.203.1 XP_013958170.1.71794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]