SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trive1|47030|e_gw1.16.438.1 from Trichoderma virens Gv29-8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trive1|47030|e_gw1.16.438.1
Domain Number 1 Region: 35-189
Classification Level Classification E-value
Superfamily EF-hand 4.21e-26
Family Calmodulin-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Trive1|47030|e_gw1.16.438.1
Sequence length 193
Sequence
MKSHQSRHFPWRSIAGGSNQHAPQVSSNEDYKAISDENRKHIDEVFDLMDMKKKGWLNSY
EFKHSLTALGFDMPKPDYYRELENYGIVPPDWRDPQSCPVNRLLIYPDQFRLCAAKLIAH
RDPREENIKIFNMFDYDQNGIISFEDMRHLAQDIKEERPMTDEEIQTMIEHLDHDGKNGV
NLEEFIQMMEEAG
Download sequence
Identical sequences G9N0I2
jgi|Trive1|47030|e_gw1.16.438.1 XP_013954061.1.71794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]