SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trive1|51364|e_gw1.28.92.1 from Trichoderma virens Gv29-8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Trive1|51364|e_gw1.28.92.1
Domain Number - Region: 417-466
Classification Level Classification E-value
Superfamily Sec2 N-terminal region 0.00353
Family Sec2 N-terminal region 0.0089
Further Details:      
 
Domain Number - Region: 143-188
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0186
Family Myosin rod fragments 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Trive1|51364|e_gw1.28.92.1
Sequence length 729
Sequence
MSSDTEGAAAVSAVAQSSGPDADAGGNKFSHAISAWRNVDLTTLISNLDNTASEIVTYQR
DSTVQRKELAQKTKDFRKSDDATKLTEIKGLLKAYQTFIDLLTNHSKSVNSAFLKAYSSL
SEAPDPYPLLEASVDSMLVSEDTLPKITEENQHLQKSVSKLTAQLEESESRLQSERAARK
DLEDNLEGKVKEVEASWTAVLDEKKDNWEAKEKTLEEKIANQERLLSELKANYEVNQRLG
KASGDDQDGQRNQASNAELEMLHADLERTSSRLAEVEARNEQMRLELAQAKSTRQSQNST
SLEDDPGYMRMRSENSSLVRKLEAARVEKEGFKRDIDGKLRSVEREVALLKEEKESLKAK
VDKWADYEEVKQELEVLKSIEFSTGDDDEVPQDIEGVPSKGDTLEKLLLARNKKLNDELT
ILRVSHQDLQRRLEDLQEELSRTNAELEKAQNLNEKLESDLENLQAEGANAFPSGASVAG
TYITRAQGRKGRISPTSSIISGIDPRTTLGEREPMGGGSGILPMVTAQRDRFRKRNAQLE
QELSESHRVVQQLRQEVAALQKDNLNLYEKTRYVSTYSRGGATTSSSSAYATNPNPSTVT
IGGTGNPGMELDRYRKAYESNISPFAAFRGRESARAYRRMSLPERVVYSITRMVLASRTS
RNLFAAYCVALHILVFFSLYWMGTADFERHASNFGSSAAAAAAGAASGGGGVSGGGASHG
EWQEDGFDG
Download sequence
Identical sequences G9NDS8
jgi|Trive1|51364|e_gw1.28.92.1 XP_013949371.1.71794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]