SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trive1|56830|fgenesh1_pm.C_scaffold_9000036 from Trichoderma virens Gv29-8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trive1|56830|fgenesh1_pm.C_scaffold_9000036
Domain Number 1 Region: 14-75
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 5.03e-17
Family Sm motif of small nuclear ribonucleoproteins, SNRNP 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Trive1|56830|fgenesh1_pm.C_scaffold_9000036
Sequence length 77
Sequence
MENGGISQAEGKDPSSFLSDIIGNSVVVKLNSGVVYKGELQSVDGYMNIALEKTAEYVNG
VKRREYGDTFVRGNNGE
Download sequence
Identical sequences jgi|Trive1|56830|fgenesh1_pm.C_scaffold_9000036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]