SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trive1|63060|fgenesh1_pg.C_scaffold_4000514 from Trichoderma virens Gv29-8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Trive1|63060|fgenesh1_pg.C_scaffold_4000514
Domain Number - Region: 230-321
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000628
Family Myosin rod fragments 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Trive1|63060|fgenesh1_pg.C_scaffold_4000514
Sequence length 393
Sequence
MDPIAIIGAASSLVLSLAKASKSLSDIRKGFQEAPMIIATMITECKTISAALTHLQNLTL
GNPVALSPSLTTPETIQEGFDNALTGCMLILSALEVHLERLVEGKKPEDMGFMKKVQLLW
NEETMNQLLSNLRGQHAAINTLVSLFQTESLANVHDLLHQHITELRLHRKRSIQLYQHSG
FESVAGQEKELSIFNFSIQSFSFTDATSNINVQLQQSTAYRNAGAVTTEELWRLNEELRD
ENGGLLDKKGHKIASLLSNNAFLQTRIDSLDQQLQAATAKIDHFSAYYKMFKQTGAECVQ
QIQHDRDQIKELEARLRNLRKSHGSMILSRLISFHEQWNELGYITPASSSRSSFVEPSAS
SHSKQADELPKPDVGSILEKTLIDIDDLITMSE
Download sequence
Identical sequences jgi|Trive1|63060|fgenesh1_pg.C_scaffold_4000514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]