SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trive1|64379|fgenesh1_pg.C_scaffold_7000046 from Trichoderma virens Gv29-8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trive1|64379|fgenesh1_pg.C_scaffold_7000046
Domain Number 1 Region: 4-118
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 2.77e-26
Family Sm motif of small nuclear ribonucleoproteins, SNRNP 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Trive1|64379|fgenesh1_pg.C_scaffold_7000046
Sequence length 120
Sequence
MKLVRFLMKCANETVTIELKNGTIVHGTISSVTPQMNVALRTVKMTARGQDSIALDTMNI
RGSTIRYFILPDSLPLDTLLIDDAPKPKNKARKEADRGGRGGRGGRGRGGRGRGRGRGRG
Download sequence
Identical sequences G9NDG6
jgi|Trive1|64379|fgenesh1_pg.C_scaffold_7000046 XP_013949926.1.71794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]