SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trive1|66616|fgenesh1_pg.C_scaffold_11000297 from Trichoderma virens Gv29-8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Trive1|66616|fgenesh1_pg.C_scaffold_11000297
Domain Number - Region: 273-340
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0262
Family Myosin rod fragments 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Trive1|66616|fgenesh1_pg.C_scaffold_11000297
Sequence length 382
Sequence
MNLLWLLFTIFFSSFVRRCYAYGERGVPERFTRALYYLSYLAEGELHKLDESTKFTIAPD
CVGSRGGRCNFEELMLHIWAPKKEGDKKPTGFKKIAGIDAKNLPNLESTSAFNKFIGGIE
NARFNTGELLTGQVDVGKLMPGKADFYDALSSIGDPIGALAAKADKDKKPDEGAVPKKPT
DQDKLLKLGKASAFYISALRGKDQDKHRRVFLEKYFEKKFPSEEGKEKIKIEIEMMNVET
PMDKKEPEEDKTKRKGKVPKWVPQSVPMIDFAKTIEKNKDKLERLEEELEKANAEFMAKE
TETNGKMERLNEAHKKAFVASKMAATATGCTRELPRELKKRDPLAELSLRSPKAARFSAG
DVIRKKKEWKDWVEREVMIIDT
Download sequence
Identical sequences G9N6F2
XP_013951908.1.71794 jgi|Trive1|66616|fgenesh1_pg.C_scaffold_11000297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]