SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trive1|72145|estExt_Genewise1Plus.C_21575 from Trichoderma virens Gv29-8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trive1|72145|estExt_Genewise1Plus.C_21575
Domain Number 1 Region: 13-144
Classification Level Classification E-value
Superfamily EF-hand 2e-30
Family Calmodulin-like 0.0000168
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Trive1|72145|estExt_Genewise1Plus.C_21575
Sequence length 147
Sequence
MASNQFDSQASTNYKEAFALFDKRGNGRCAIDSLGDLLRACGQNPTLAEIQELEKGLGSE
FDFEAFQRILNRPGGFRDPGEPEEYCRGFQVFDKDMTGFIGVGQLKYILTNLGEKMTEEE
VDELLKAVDTSSGQINYTDLVRTILAN
Download sequence
Identical sequences G9ML31
jgi|Trive1|72145|estExt_Genewise1Plus.C_21575 XP_013959122.1.71794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]