SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trive1|72779|estExt_Genewise1Plus.C_31358 from Trichoderma virens Gv29-8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trive1|72779|estExt_Genewise1Plus.C_31358
Domain Number 1 Region: 343-452
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000068
Family Myosin rod fragments 0.0066
Further Details:      
 
Weak hits

Sequence:  jgi|Trive1|72779|estExt_Genewise1Plus.C_31358
Domain Number - Region: 203-279
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.000955
Family Mitotic arrest deficient-like 1, Mad1 0.013
Further Details:      
 
Domain Number - Region: 155-195
Classification Level Classification E-value
Superfamily N-terminal coiled coil domain from apc 0.0418
Family N-terminal coiled coil domain from apc 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Trive1|72779|estExt_Genewise1Plus.C_31358
Sequence length 573
Sequence
MADAEEKERQKQEKLAAARKRVEQMKKKKKKDASSTKAEPKGDAEASAPDTVEDTPEQSQ
EAQPDDNAADDNKATEDDKATEEPNVEEEPKVEEEPKAEEEQTEKAVESPPSDTPSLAQQ
SKLRSTSFRAGSIVGPGPMSPGPFSPEGDTLPDIYRKHVARIEELEKENKRLTKDVTDSE
KRWKKAEEELADLRESDGKDSKDGQTEKLKEEIASLQRQNSQLQQQVSRTSGHAHRQSVS
INASPPSLQAELQAKSTQIEHMEGEISKLKALVERQESGASSEKEQITALEDKVARAEAA
AGKAQRELQDLKKNLERTTEKAVREGSERTSAETKAKTLERELDEANKAKEELEKKAEAL
EKKVTTLTTLHKEQDARSQTLRKDKEKAESEAQELRSRVEKLESENAKLASRKSADGGGG
LDDEGVDELEDEGRLKLEKKIRSLEAEIHELRSGAWIERRREMEATSPGFDDVDLSGNNH
PPAHKKGSTGGIGDFIAHGLNALAGGGDDDLLADDDVEFDEEAFRKAHEEEAKRRIERIK
EIKRSLKHWEGWRLDVVDVRRGGGQGIGDIFDI
Download sequence
Identical sequences G9MJL9
jgi|Trive1|72779|estExt_Genewise1Plus.C_31358 XP_013959884.1.71794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]