SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trive1|77402|estExt_Genewise1Plus.C_190147 from Trichoderma virens Gv29-8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trive1|77402|estExt_Genewise1Plus.C_190147
Domain Number 1 Region: 1-188
Classification Level Classification E-value
Superfamily EF-hand 9.51e-55
Family Calmodulin-like 0.000001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Trive1|77402|estExt_Genewise1Plus.C_190147
Sequence length 190
Sequence
MGKSQSKLSQEQLAELQKSTHFDKKELQQWYKGFLKDCPSGMLSKEEFQKIYRQFFPFGD
PSSFADHVFNVFDSDKSGSIDFKEFICALSVTSRGKMEDKLDWAFQLYDIDGDGKISYDE
MLQIVEAIYKMVGSMVKLPEDEDTPEKRVRKIFRMMDKDENGSLDMEEFKEGSKRDETIV
SALSLYDGLV
Download sequence
Identical sequences G9MZ34
jgi|Trive1|77402|estExt_Genewise1Plus.C_190147 XP_013954624.1.71794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]