SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trive1|78277|estExt_Genewise1Plus.C_280117 from Trichoderma virens Gv29-8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trive1|78277|estExt_Genewise1Plus.C_280117
Domain Number 1 Region: 11-126
Classification Level Classification E-value
Superfamily ENTH/VHS domain 0.00000000000798
Family VHS domain 0.078
Further Details:      
 
Weak hits

Sequence:  jgi|Trive1|78277|estExt_Genewise1Plus.C_280117
Domain Number - Region: 205-271
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0207
Family Myosin rod fragments 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Trive1|78277|estExt_Genewise1Plus.C_280117
Sequence length 394
Sequence
MAYNDDSVLARLSALNESHDSIATAAQWIMFHRRHADRTVALWMQRLKDSSSTKRLSLVY
LANEVTQQSRIRHKEDFIIAFSPVIAEAAAVAYKGAPAEIQAKLRRVIDVWKDRVIFEAP
IQAAIEARLNAELDKARGSVKPGFGGSPFGSSALVPSEFTPLVSAHQTVTKLSVPLKTTI
ASASSEYEKQVDPTVPAPSAPVYAARLNGLLKTLASAESAVAECVKARESLISGLEKMLD
SNRAALENEKNAASELSGRKREIEEKKQQVEVAIMRALGPADGNGAHAEGESGNPPTELD
RPEMEALTPPAMDDDFEDTRPDDIEYDEDVRPSEDVPATEPSSTAPSTYTQSLPISTNGS
NKRRRLDDGGDFPDLGNDGEIDAEVAEMLKEGSE
Download sequence
Identical sequences G9NDR6
jgi|Trive1|78277|estExt_Genewise1Plus.C_280117 XP_013949359.1.71794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]