SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trive1|78858|estExt_fgenesh1_pg.C_10625 from Trichoderma virens Gv29-8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trive1|78858|estExt_fgenesh1_pg.C_10625
Domain Number 1 Region: 1567-1698
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000213
Family Pleckstrin-homology domain (PH domain) 0.039
Further Details:      
 
Weak hits

Sequence:  jgi|Trive1|78858|estExt_fgenesh1_pg.C_10625
Domain Number - Region: 56-125
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0288
Family Myosin rod fragments 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Trive1|78858|estExt_fgenesh1_pg.C_10625
Sequence length 1890
Sequence
MASSSVTSDRPDLSVPVGDGASDPFFSASSTTPSHLRFSDFDQELFAAGPGSDPRQAKRA
LEAHLAETDRRLDEAGKIGTALVSQRKALAEQLQEIEKLQAEEELAPELRRKLVSIEKDY
NDLARESARVFLPKQRVASTSDNNQSSPYTLDSRSDRRSVSPSKFESQASTSPTKLNVPN
RKMRNQPSNRVHDIEFAAEISTSLIAQVRNLQALLGERDEQVKDLRNDVARLEGDSEALQ
QRLKVLDESEHRFKEENWNLQTRLQEMNGQQKEASDREKKLDNALHASNAAKSATQKELD
EVKLSLSKLTEEHAASTKHHDIELGTAKRAIAMAEGERSAMQRKIDELTSQNLELAKAIA
AQRAKAQERESSSGTSDEDLEAAAIDITPEHSPPVSPMKGTTPRHSMLETETLKTSLQHA
QRTIQSQRSQLHREKTEKLEFRRIIQDLRDDLEKARNELEKGPAPPPVRRGRRVEPKEVK
VRPPRLLGSFRSSRQEVVMEEEIAPEDPEWEDTHDISPRSSALRAGGFSPERHQQLLLQQ
QQRQRQSSDASDGDEIVLESIETSDSFETAAEEGNDSAFETANEPGTETEDFQTGHEDLS
DESDAPTEVALSIRGFGNMRRPPSLQPGLSRHVLRESFDSTASTSTEEDEFPEFPEYRTP
TAAAAMRRMRMSNRSSMSRRSSRQESEEPQFQSPGASFSSGGGDPATPGQSLFAELQDFP
SDDESSILYTPGRRSLRSMTPASTRRPVTPPPAVPRLPRVIMVDSGVMTDPIEFGPSLEP
LGHRISRGSLLSVGEAARRPRSMESVIPNTDFRASAASWRSVEDGPAGSATYSRPASTIA
YSDAGAQYDIGEKLAQFPLPPSSLPSEPDLIPIPVPAPPAVLNLSVIQSEDIEPREEQHQ
EPAPAAVPPTLSLTPMAFETVEPLAEPEVPAPHLRLSAIVAEHLEPEAEPDVPPPDLTLS
SIFAEGLEPRAEPELPPAELTLSTIIGEGLEPVAEPEIPPAALSLSTIVGEGLEPVAEPE
IPLPTLSLSTIATEGSEPVEEPELPAPVLSLSTIVAEDLEPKAEPKAPLPELTLASILSE
EVEPVIEEPVVPELTAAKAIVPEEAPVVVLQELSISPIVTEQVEPIAEPEVVVPPPPSLT
MSSIQAQQLEPREIWLPTLTLSTIAVENVEPIAEPEPEPVSAALTLSALSFQNTIPFDEL
PIDDEELLLPSPPPQPEAPTLGLSSIVAEDVEPIFPLAPQFAFSSISSVETQPISPVKRG
GFILPRDIKSPFNDEDGGVSDKNLFASYVTRRRPESVPSSPIVAEDETSQSRPVSPQVDT
FESERPLREITVNGTSRPGQQLAQTSDQGAQTSLTSGAIDELLKTGIETPAKSHYTIGSP
DTVGIAKVNRAYQESLDRPFSAVSSKNRTLEPAPIFESTPMRRPGSANSTKSSLMDAPPL
PSNHQEMIQAARSGSSNGTMKSQNQNQDQSQSQGTMGPSLRPSSATKQTPHTPSRDRPMS
PPSGRGTPTPRAPVRAGSSHGTAEFPLPPPVRLSAAMSRQSSVTSFASELDNRFGMRANE
MGLDPTGFGPNTDPRMIQAITQTMIGEYIWKYTRKAGRGELSEKRHRRYFWVHPYTRTIY
WSEKDPSTAGRTEMKAKSLPIDGVRVVTDDNPMPPGLHRKSLVIISPGRTIKFTCTTGQR
HETWFNALSYLLLRTSNGHDGHSDAEEMAADLTREDVDEFNPQFGRRPANGTSRPSAPSL
SSYNSRATSQAEAISLEIPTLTPSKHASTPIRPSIAGSISSRVGSYWKVGGSKLSGSIRS
RTVSAQNVSIYQGSEVHDSAEDLREMIEQQDREADRLENVRACCDGKHDVGTLPHTTQKG
RSHKHHHHTTHSNGGHSALNTPMASMRSRA
Download sequence
Identical sequences jgi|Trive1|78858|estExt_fgenesh1_pg.C_10625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]