SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trive1|85975|estExt_Genewise1.C_41484 from Trichoderma virens Gv29-8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trive1|85975|estExt_Genewise1.C_41484
Domain Number 1 Region: 16-168
Classification Level Classification E-value
Superfamily EF-hand 6.18e-43
Family Calmodulin-like 0.00000755
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Trive1|85975|estExt_Genewise1.C_41484
Sequence length 174
Sequence
MGNTTSTVLDNIVQGSNFDREEVDRLRKRFMKLDKDNSGTIERDEFLSLPQISSNPLATR
MIAIFDEDGGGDVDFQEFVSGLSAFSSKGNKEQKLQFAFKVYDIDRDGYISNGELFIVLK
MMVGSNLKDQQLQQIVDKTIMEADLDKDGKISFEEFTKMVENTDVSMSMTLDQF
Download sequence
Identical sequences A0A024S190 A0A1T3CFW8 A0A2K0TS53 A0A2K0UBI6 G0RV16 G9MEC8 G9NF52
jgi|Trire2|52130|estExt_Genewise1.C_280089 jgi|Trias1|204732|estExt_Genewise1Plus.C_200062 jgi|Triha1|7107|gm1.7107_g jgi|Trici1|23145|fgenesh1_pg.15_#_68 jgi|Trive1|85975|estExt_Genewise1.C_41484 jgi|Triat1|145322|estExt_Genewise1.C_160537 51453.JGI52130 XP_006969082.1.9351 XP_013948731.1.20613 XP_013961622.1.71794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]