SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trive1|90246|estExt_Genewise1.C_200216 from Trichoderma virens Gv29-8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trive1|90246|estExt_Genewise1.C_200216
Domain Number 1 Region: 11-93
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 6.54e-22
Family Sm motif of small nuclear ribonucleoproteins, SNRNP 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Trive1|90246|estExt_Genewise1.C_200216
Sequence length 97
Sequence
MADVGEESSHVAEPLDLVRLLLNEVVFVKLRGDRELKGKLHAYDSHCNLVLGDVEETIYA
VDDDEEEGDEVKTISRKSEMLFVRGDSVVLISPQVPF
Download sequence
Identical sequences G9MYC2
jgi|Trive1|90246|estExt_Genewise1.C_200216 XP_013954740.1.71794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]