SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trive1|90536|estExt_Genewise1.C_230079 from Trichoderma virens Gv29-8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trive1|90536|estExt_Genewise1.C_230079
Domain Number 1 Region: 200-274
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 2.62e-25
Family LSM14 N-terminal domain-like 0.0005
Further Details:      
 
Domain Number 2 Region: 16-100
Classification Level Classification E-value
Superfamily t-snare proteins 3.45e-22
Family t-snare proteins 0.00087
Further Details:      
 
Domain Number 3 Region: 137-196
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.0000000000000126
Family SNARE fusion complex 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Trive1|90536|estExt_Genewise1.C_230079
Sequence length 731
Sequence
MANPLDTDAGSELFSSYEAELKLVQADLAQKLDQIPELTGEPRKAAVSQAERALEEADEL
LGQMRLEKQNIPTSARAKVNQRFRNYEADIDTNRRKLTSLSSNRAALFGSRYTDEPSGST
DINLEQRQQLLSGTERLDRSTQRLLNSQRLANETEAIGAETLADLHRQGEVIRHTHDTLL
DSEGYVDRSVKTLRGMARRSRISLISKSDIRYVGTLHEINSDESTVSLENVRSFGTEGRR
GRPEEEIAPSDQVYEYIVFRGSDVKDLRIEEHPAIKENKPPAMPDDPAIVGARARPGAQG
PNQNAPAGAPPGAPGFPQHQYPPNQFYGGPPPPGSWGRGGPGPMAGPGFGNAPFPPGPPP
PGWYPPPGQGFPPGPGGPGPWGNAPFPPGPGGPPGSEVPQGQRAPELPSTQESKVPPIGP
GADKPKGAPPTEPKAHAQAARQPSNAPAPPVESKPSAEEVKAVATTLASNGAAKANDAPK
AIPTGPKANRVQPVLPLTGPASKPFQPPFAAEKASQSVPQSAAAGPSSVQDATSAARAAV
ALAMAQLSNTGGNAMDNLTNKVQEMRVNASRGGNVNRGRGRGGRPTKVEVPDADFDFAQS
NAKFNKEDVVKEAIAGSPSAEAPAVPVTEGSEPQDGTTPVAYNKSRSFFDNISSEAKERA
ENNGQKPGGREWRGEEQRRNIETFGQGSVDGGYRNYRGRGRGRGTRGGGRGYSRGGRGGP
RPQYQPTAAGQ
Download sequence
Identical sequences G9MGF7
XP_013960804.1.71794 jgi|Trive1|90536|estExt_Genewise1.C_230079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]