SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trive1|92525|fgenesh2_kg.C_scaffold_10000022 from Trichoderma virens Gv29-8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trive1|92525|fgenesh2_kg.C_scaffold_10000022
Domain Number 1 Region: 15-133
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000000418
Family Myosin rod fragments 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Trive1|92525|fgenesh2_kg.C_scaffold_10000022
Sequence length 220
Sequence
MRRAEALVIEVQKDVAAERENAAGLQKQKTSLEKSLSEAQLKLIDLETKGYSSGSQDIKF
LHKRIQELESQLDSHEEEKNKSQRSVRNVDRTVKDLQTQIERKDKQNTQLTDDVNRMRDR
VDKLLKTIDELQASESTNQLSARRAERELREEKEKCHRLERELEGWKGLRMEKGSAPAGS
VRGRGVTWRTGSEGEDSTLIDVPQRNSSLNRAPSMTKGFL
Download sequence
Identical sequences jgi|Trive1|92525|fgenesh2_kg.C_scaffold_10000022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]