SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trive1|56457|fgenesh1_pm.C_scaffold_7000268 from Trichoderma virens Gv29-8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trive1|56457|fgenesh1_pm.C_scaffold_7000268
Domain Number 1 Region: 9-641
Classification Level Classification E-value
Superfamily Sec1/munc18-like (SM) proteins 1.57e-136
Family Sec1/munc18-like (SM) proteins 0.00017
Further Details:      
 
Domain Number 2 Region: 1008-1217,1244-1438,1553-1593
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.81e-66
Family FAD-linked reductases, N-terminal domain 0.00012
Further Details:      
 
Domain Number 3 Region: 1419-1539
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.29e-26
Family L-aminoacid/polyamine oxidase 0.00031
Further Details:      
 
Domain Number 4 Region: 900-998
Classification Level Classification E-value
Superfamily Homeodomain-like 2.6e-23
Family SWIRM domain 0.015
Further Details:      
 
Domain Number 5 Region: 1639-1735
Classification Level Classification E-value
Superfamily HMG-box 0.00000000000353
Family HMG-box 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Trive1|56457|fgenesh1_pm.C_scaffold_7000268
Sequence length 1784
Sequence
MAPRAEFSTEQIRGKARKDLLYLLEGVRGKKNLVFDRSLVGPIGTIVKVATLQEYGVDKF
FILENNNVDASQRNVVFVARGECGRHAEAIAAQIKRIQRESQTTHDFHIFWVPRRTLVSD
QLLEEAGVLGDVNISELPLLFFPLEDDVLSLELEDSFKDLYLSKDVTPNFLMAKALMEVQ
QNHGLFPRIIGKGDNAKRVADLLVRMRQERLAGEDGSDVKTALTPSTTNESVIIIDREVD
FVTPLLTQLTYEGLIDEIFEIQNNQAKVDTTIVGAPAQSSAATSQSRKRTVQLDSSDKLY
EQLRNANFAIVGGLLNKVARRLQKVQTDYESKHKTKTIAELKEFVSQLPGYQQEHQSARI
HTGLAEEIIKHTRTDLFKGLLEVQQNLAAGADPSSQFDGIEELIAREAPLRETLRLLCIY
SCISGGIKPKDLEQFKRLILQGYGYQHLLTLNNLEKLQLFLSRSSPLAGMIPMTGNAGAD
GTKTNYTYLRKQLRLIVDEVQEDDPNDIAYVYSGYAPLSIRLVQCILQKQYLLSITKGNV
PANAGGGAPGAGTQGWQGFDEAVKHVRGQTFYELQKGEDKAVKARALLSGSGHKQTVFVV
FIGGVTFTEIAALRFIAKQEEGRRNIVICATSIISGNRMMDAAIEKEAVQIHSLASEAPN
DLLFRLQNRYIHPRVRATDVFDGRLPRHMMRLPSVMLLEKDVPIGPSFSHPQDVDSSSIS
SLAPEPVTKSQSQSQSQSQIPASPSSSLSYPQVSGQGSSDESSEVAPEIVVWTEEMDLSS
SSLSSHDPEGSSGMHLDTDDERHQHGDDSPLPAEPTDDAIAESFSSSHSSLTELSDASSS
PSIVSSKATTPVETEIPSRPQITGVAQSFSASSHRHDIERLTFNVRPKSSVPTDIPSYQY
ASECIAAAESSRLNPYALHPEEYHFLRHHISHSQVTTYLNIRNGILRIWMKQPSVSVTRH
EAVGCANARWFDAANVCYDWLVRRGYINYGCVQLPEPQTESRNEPPTKKRKTIAVIGAGI
SGLSCARQLDGLFKQHAGHFYARGEEPPKVIVLEGRGRVGGRVYSREFKTRPAESETEFK
GMRHTAEMGGMIITGFDRGNPLNVIVRGQLGIPYHSLTAETTIYDSNGKPVDPVRDLLVE
KLYNDCLDRVSEFKFKSQSSKLIEGNRDLIDDGRDSPGDGSKTIMQAEEATAALPDAPSV
SQQNVPETVNMVPVSADKLTGRVHNEPGVPATIKASEKARLMGWNIRPGAAEKGNLDLTP
ATTLEGSTLGSVLDHAITQYKNIVELNAQDHRLINWHIANLEYSNATNLHNLSLGLWDID
AGNEWEGHHTMVVGGYQSVARGLLQCPSPLDITTKFPVQKITYNGKGFDGPASIESEDGT
QVEADAVVCTIPLGVLKQGNINFEPPLPSEKVDAVGRLGFGILNKVVLLYDKIFWDSDRH
IFGVLRDASNRHSTSQHDYSTNRGRFFQWFNVTNTTGLPCLIALMAGDAGFDTEHTSNDS
LVAEATEILRSVFGKDVPYPIETVVTRWGSDRFARGSYSSAAPNMQPEDYNVMAQPTGNL
FFAGEHTIGTHPATVHGAYLSGLRAASEVLESLIGPIEVPTPLVLPRDSLLLHKRKEAAK
DPRQARLEAYEIEVWEYVLSKIGERPLRPNKVAGSAYILFSKAHFEAAKKKCEESRKPGK
TRSLPNEVRIMTSRMWKEATPDERKPYEEQAAEQKKLYLQAMQEYNELAEKWDRKAITLR
AAYEQEHPSLPGPEEGPEDASMMQKHRRARNVSYAEGGDSDMGS
Download sequence
Identical sequences G9NCJ7
jgi|Trive1|56457|fgenesh1_pm.C_scaffold_7000268 XP_013949622.1.71794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]