SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trive1|60622|fgenesh1_pg.C_scaffold_1000607 from Trichoderma virens Gv29-8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trive1|60622|fgenesh1_pg.C_scaffold_1000607
Domain Number 1 Region: 129-212
Classification Level Classification E-value
Superfamily HMG-box 2.49e-20
Family HMG-box 0.0011
Further Details:      
 
Domain Number 2 Region: 260-353
Classification Level Classification E-value
Superfamily HMG-box 0.00000000000384
Family HMG-box 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Trive1|60622|fgenesh1_pg.C_scaffold_1000607
Sequence length 371
Sequence
MDISQQIPPPSNEVAIYLAAIWDRLKDQINPFLQVLLIDDSMYRMLDTYGRRYIARKFME
HTRESAMYCRDGNREDRHYLGAPRYFIATGGVLHSADGLEPIWTMDDGLNTRFETAAVCQ
PTVPSKPTKIPRPPNAYILYRKDRHNIVKAANPGITNNEIFPIAAQILGRAWNQESREVR
QKYKEMSEEIKLALLEKHPDYQYKPRKSSEKRRRTRRSQQAHALLVEANLAAPDNETAED
NSLWCILFPLRLGDNGREANRIPRPRNSWILYRQFLSGEFTKCYLGITASELLGSSSVHA
LMYRYLYEATLISTKWKSEPPHEKKFWHDLAEQEKRNHKQNYPDYKYRVRKPQAKKRKGR
QTVAAAVLETD
Download sequence
Identical sequences G9MQZ8
jgi|Trive1|60622|fgenesh1_pg.C_scaffold_1000607 XP_013957388.1.71794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]