SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trive1|61379|fgenesh1_pg.C_scaffold_2000384 from Trichoderma virens Gv29-8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trive1|61379|fgenesh1_pg.C_scaffold_2000384
Domain Number 1 Region: 162-236
Classification Level Classification E-value
Superfamily HMG-box 0.00000903
Family HMG-box 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Trive1|61379|fgenesh1_pg.C_scaffold_2000384
Sequence length 296
Sequence
MPAKRKLVAEANIEPASVPSTLPPSVEEAYRRKCVQLKNRTNEVEDANDAARLRLARIKR
QVEKLRIERAFLLEQLAKRTSTNVEDSEGSPSPPPTATSFDIPTESNANPRKPKDKPLRI
KKGHRKSNAPADADAKQSSAKEPTSPASESNSQAKRSRANGVAKSSKEPKTAFELYCEEA
RPALEAKDKDDKDDKDDKDDKDDADVNIDEELKRDWEELPETEREEYQAKADQLSKSQEE
DDKAAAEADAENESPKKSSVKAEPEAEKPEAHDDDVEMSNYDTEDQETQMDKDGDD
Download sequence
Identical sequences jgi|Trive1|61379|fgenesh1_pg.C_scaffold_2000384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]