SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trive1|73899|estExt_Genewise1Plus.C_60280 from Trichoderma virens Gv29-8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trive1|73899|estExt_Genewise1Plus.C_60280
Domain Number 1 Region: 43-196
Classification Level Classification E-value
Superfamily EF-hand 2.04e-27
Family Calmodulin-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Trive1|73899|estExt_Genewise1Plus.C_60280
Sequence length 200
Sequence
MNSHTPRPFPGRSIAGGSNQHAQPRNPPAPQVSSNEDYGTIADEDREHIDEVFDLMDMKK
KGWLNSYEFKHSLAALGFDMPKPEYCRELENYGTVPPDWRDPHSCPVNRLLIYPDQFRLC
AAKLIARRDPREEAIKVFNMFDYDQDGIISVEDMRHLAQDIKEERTMTDEEIQTMIEHLD
HDGKGGVNLEEFIQMMEEAG
Download sequence
Identical sequences A0A0F9XQR1 A0A1T3C632 G9MP85
jgi|Trive1|73899|estExt_Genewise1Plus.C_60280 XP_013957896.1.71794 jgi|Triha1|494312|fgenesh1_pm.5_#_595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]