SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trive1|81710|estExt_fgenesh1_pm.C_10376 from Trichoderma virens Gv29-8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trive1|81710|estExt_fgenesh1_pm.C_10376
Domain Number 1 Region: 30-157,193-229,276-301
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 5.97e-33
Family Phospholipase D 0.083
Further Details:      
 
Domain Number 2 Region: 309-436,533-593
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 6.63e-27
Family Nuclease 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Trive1|81710|estExt_fgenesh1_pm.C_10376
Sequence length 772
Sequence
MGLFGKVEAFFGGEQNDEKHSHSHSGYQCDEHHPAEHAANRYQSFAAPSSGNIKWFVDGC
SYFWAVSEALQRAQESIYILDWWLSPELYLRRPPSRNQQYRLDVMLQAAAERGVKVHVIV
YKEVEAALTLNSAHTKHALEKLHPNISVFRHPDHAPAGYDIASEIGNSFKNLTNFNLATM
SKDTLKAIYGAADDVVLYWAHHEKLLVVDRNLVFMGGLDMCFGRWDTNSHPIADAHPGNV
DNIIFPGQDYNNARIFDFADVGNWDQNQLDRTKSSRMGWSDVALSMNGPIVSDLVSHFVD
RCCCKWSSGHATEHSIANAYVSAITNAKHFVYIENQFFITATSDEQLPVANKIGAAIVDR
IVRAYEEGQPFKVWVLMPAVPAFAGDLKSKEALGTRAIMEFQYNSISRGGHSIIQKLVAA
GIDNPREYIGFYNLRNYDRINTSSTLQQAEYRSGVSYEDARRSHDDYVNEERYGRDEGRY
GRDEGRYGRDEDSYGPQSVQDDTLDTVSSAYMKHGPNIAEISWNGAPQDEFNAFVSEQLY
IHTKLLIADDRLVICGSANLNDRSQLGTHDSEIAVVIEGPTTLDSYMNGEQYAASEFAAS
LRRQIFRKHLGLIPDQRWDQPTQNWLPVTDAPNDYDWGSSADRLVEDPLSPDFLNLWEDV
ARTNTEVFSRAFHPVPDDRVRTWEDYDEFFSKHFIIPTAKGDDKKPKDGEQGKVPYGHAV
PEEFPGGVRELKEWLGRVRGNLVNMPLQFLIDVKDIAEEGLTLNGLTDELYT
Download sequence
Identical sequences G9MTQ1
XP_013956624.1.71794 jgi|Trive1|81710|estExt_fgenesh1_pm.C_10376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]