SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trive1|82509|estExt_fgenesh1_pm.C_70024 from Trichoderma virens Gv29-8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trive1|82509|estExt_fgenesh1_pm.C_70024
Domain Number 1 Region: 3-90
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 1.06e-22
Family Sm motif of small nuclear ribonucleoproteins, SNRNP 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Trive1|82509|estExt_fgenesh1_pm.C_70024
Sequence length 98
Sequence
MLFFSFFKTLIDHEVTVELKNDIQLKGILKSVDQYLNIKLDDIQVVEELKYPHLSSVKNV
FIRGSVVRYVHLPAASVDTQLLEDATRREAAAQQAKAK
Download sequence
Identical sequences A0A024SK37 A0A1T3CPB8 A0A2H2ZMM5 G0RE46 G9NDI6
XP_006963128.1.9351 XP_013949946.1.71794 jgi|Trilo1|63348|fgenesh1_pm.1_#_327 51453.JGI46320 jgi|Trias1|156922|estExt_Genewise1.C_1_t40406 jgi|Trive1|82509|estExt_fgenesh1_pm.C_70024 jgi|Trire2|46320|estExt_Genewise1.C_41036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]