SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000001437 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000001437
Domain Number 1 Region: 102-305
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.49e-58
Family DBL homology domain (DH-domain) 0.00033
Further Details:      
 
Domain Number 2 Region: 288-436
Classification Level Classification E-value
Superfamily PH domain-like 1.59e-32
Family Pleckstrin-homology domain (PH domain) 0.0027
Further Details:      
 
Domain Number 3 Region: 399-439,476-536
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 4.7e-22
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0022
Further Details:      
 
Domain Number 4 Region: 567-663
Classification Level Classification E-value
Superfamily PH domain-like 8.84e-20
Family Pleckstrin-homology domain (PH domain) 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000001437   Gene: ENSACAG00000001307   Transcript: ENSACAT00000001472
Sequence length 677
Comment pep:known_by_projection scaffold:AnoCar2.0:GL343225.1:2098395:2147128:-1 gene:ENSACAG00000001307 transcript:ENSACAT00000001472 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLSELNGNGKIPNRDSGIDSPSCSVAGETFLNEDGAEQRKATVTGSPAAEMESDKKGVRV
SGGEQKRDSAQDEDSDIDELPNSDSSCRPTEEDSRLLQCSEPQKLFNIANELLHTEEAYV
KRLHLLDQVFCTKLYEAGIPPDVVTGIFSNISSIYRFHEQFLLPELKTRITDEWNTNPRL
GDIFQKLAPFLKMYGEYVKNFDRAMDMVNTWMQRSSPFKDVIQNIQKQDVCGNLTLQHHM
LEPVQRIPRYELLLKDYLKKLPGESPDRKDAEKSLELISTAANHSNAAIRKMEKMHKLLE
VYERLGGEEDIVNPANELIKEGHIQKLSAKNGTAQDRYLFLFNSMVLYCVPKLRLIGQKF
SVREKIDIAGLQVQEIVKQNVAHTFSITGKKRSLELQARTEEEKKEWIQVIQATIEKHKQ
NSETFRAFNNSFSQEDEHLPDSSIASTSSVESMPGTDGSSTSGGPESCRKSSKLKRDKEK
HACKSCGESFNSITKRRHHCKQCGMVICAKCSEFKTLADNSRQNRVCKDCFQLPSVTPCI
SGNESAGEQKKKIATEKQTILGAENSIFSSYLLFQEKGKTWCKVWVTIPKAEPLILYLQG
GSQDGRVPRSIPLPGYEVDFPHSGEKFESKYVFKLCQSQQTLYFSADDEDLQIKWMDILT
KAAKGEIQNPSEESSNS
Download sequence
Identical sequences H9G582
ENSACAP00000001437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]