SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000001799 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000001799
Domain Number 1 Region: 23-462
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.57e-101
Family Integrin alpha N-terminal domain 0.00000000000109
Further Details:      
 
Domain Number 2 Region: 762-990
Classification Level Classification E-value
Superfamily Integrin domains 9.42e-66
Family Integrin domains 0.0000000159
Further Details:      
 
Domain Number 3 Region: 463-619
Classification Level Classification E-value
Superfamily Integrin domains 3.19e-45
Family Integrin domains 0.000000343
Further Details:      
 
Domain Number 4 Region: 621-755
Classification Level Classification E-value
Superfamily Integrin domains 2.51e-39
Family Integrin domains 0.000000774
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000001799   Gene: ENSACAG00000001328   Transcript: ENSACAT00000001843
Sequence length 1041
Comment pep:known_by_projection scaffold:AnoCar2.0:GL343737.1:30207:112534:1 gene:ENSACAG00000001328 transcript:ENSACAT00000001843 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAMAGLPWLLFLFLALPPGRAFNLDVESPAVYSGAEGSYFGFAVDFFAPDGASMSLLVG
APKANTSQPGIVQGGQVLKCNWNSNRRNCQPIVFDTTGNRDFAVNDPLEFKSNQWFGASV
RSKDDKILACAPLYHWRTEQKAEREPVGTCYLRDGSKIVEYAPCRSTNIDAEGQGFCQGG
FSIDFTQADRVLLGGPGSFYWQGQLISDEVAEIVSKYNAKVYTTKYENQLATRSASAAFD
DSYLGYSVAVGDFDGDNIEDFVSGVPRAARTLGMVSIYNGKTMASMYNFTGEQMAAYFGY
SVAATDINGDDYADLLIGTPLFMDRGSDGKLLEVGQVSIYLQQASGGFQSPVMKLNGFEV
FARFSSSIAPLGDLDQDGFNDIAVAAPYGGEDRKGLVYIYNGRPTGLNGVPSQVLEGQWA
SETMPPSFGYSLKGSTDVDKNGYPDLVVGAFGVDKVALYRARPVITVTAVLEVTPAILNP
EDKSCEDNNQKFSCFTVKFCLKAEGKGNLPRELTFQVELLLDKLKQKGAIRRALFFHSRQ
SGHSKNMTVPRGGRMRCEELQAFLRDESEFRDKLTPITVFMEYQLDYKTASDSTGLQPIL
NIFTPANISRQAHILLDCGGDNICQPDLQVTVDSDQKQIYVGDDNPLTLIINAQNLGEGA
YEAELFVTVPPQADFIGIVRNSEALARLACAFKTENQTRLVVCDLGNPMKAGTKLSAGLH
FSVHQESEMDTFVKFDLQIRSSNLFNNESPTVSYQVDLAILAAVEIRGVSSPDHIFLPIP
NWQPKENPETEDDIGPLVQHIYELRNNGPSAFSKVMLNLQWPYKYNNNTLLYIIKYEIEG
PMSCTSDMEINPLKIKMSASEEDEKNETINGENTRDHHINRRDLSAAEGDVQTLGCGTAE
CLKIVCQVGRLERGKTAVLYLKSRLWTQTFMNKENQNHSYSLKSSASFSVIEFPYKNLPF
PEDVHNSTIVTTNILWGIQPAPMTVQVWVIILAVLAGLLLLALLVFVMHKVGFFKRVRPP
QEEQEREQLQPHENGEGTSEA
Download sequence
Identical sequences H9G5P5
XP_003228896.2.98722 ENSACAP00000001799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]