SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000002715 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000002715
Domain Number 1 Region: 370-767
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 4.32e-41
Family Integrin alpha N-terminal domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000002715   Gene: ENSACAG00000002705   Transcript: ENSACAT00000002783
Sequence length 836
Comment pep:known_by_projection chromosome:AnoCar2.0:4:54051722:54088878:1 gene:ENSACAG00000002705 transcript:ENSACAT00000002783 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEALKILSTLAIISTFCQSVIPCGLSTHIEIVHDYLEKEYISFNKLKYRHLISNWQDAYQ
AGRLYPDAFYSGICKNGIFHQVSEDTHWSPFLNASVHYIRNNYPQPWETATEKLVAFLFG
IASHMVADVSWHSLGIDQGFLRAMAAIDFHGSYADAHSAGDFGGDVLSQFELDFDYLAPN
WYVPVKDLLSIYKELYGQEVITEETIVDCAHLQFLELYGEVIGIAKIYPFYARKSPFLVD
KFHDYFLGGVDDMAFASNNIFQQTSQILAHGTSGCFIPENPLYIRCKDEQRYPTRSRPSK
TEHHSNKTSSLAKSVEKNINYTERGVYFDMPAWATNYLYFRNSAAAKGLTSVLTITQQES
SHHITKPTASYFLKTPYAKLGWAMISADLNQDGYDDLVAGAPGYSRLGHIQIGRVYIIYG
NKSGLPHTDLDLDQEADEILEGNKPSGRFGSSIAALDFNEDGVLDLAVGAPSVGSQELSY
RGFVYIFFGNRRGGGFHKTPNITIACQKIYCNFGWSLLAADVDGDGNHDLVVGSPYAPGR
GKQRGFVASFYSFFNRSSQGQLSVSDADWIVKGQTDYAWFGSSLSSVQLQNRTLLLIGSP
SWKSCTGMRCYFSDDTRQAVGRVYGYIPPNKRSWFTLTGDMDMGNFGSSLATGFLSVEGI
LRHVLVVGAPTQDSPSKFVFIPSVLHQAGAALMYDLREDTEPHLLSSFNGDRRFSRFGGD
VHLSDLNNDGLDEIIVTSPLRSKDIVAGVLEGESARIYIYSGNQTVSGKVTNQCKSWTTP
CPEDWAEYVIISPEEKSRFGSAVITVKSGQQNDIVVAAERSSVKARLSGRLFIYTF
Download sequence
Identical sequences G1KB68
ENSACAP00000002715 ENSACAP00000002715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]