SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000002857 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000002857
Domain Number 1 Region: 5-165
Classification Level Classification E-value
Superfamily RUN domain-like 8.24e-31
Family RUN domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000002857   Gene: ENSACAG00000002827   Transcript: ENSACAT00000002928
Sequence length 991
Comment pep:known_by_projection scaffold:AnoCar2.0:GL343433.1:228837:286434:-1 gene:ENSACAG00000002827 transcript:ENSACAT00000002928 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAGKEHWKLLGSLKSTVEGLVSISNPNVWSKYGGLQRLCRDMHGILYHGLIPDKVCCQQ
RDYWHFVKDIRWLSPNAAHHVEKFISLHENGQRNADRAIAELWLQHSLQFHCLSAQLKPL
LENKQYVRKFYADSAFLLSDAHVTVMLQCLEAVEQNNPRLLAQIDASMFARKSEVSMPMT
KSQSLTALPGSMCIPPAESTTPCYFGSFSGVHTAAASIQDRRFSSTLVCSSSSSQPQENA
PCASSSHWQPEGRSPPRLIAPQLTVSCPKDSSPTGEMSATGTSVDPSDDPWAGGQDDTDG
PEYLAIGNLGRQSRSCDSPSESNAATPNSAGSSTSNLFSSSSSQKPESLSSLSEHGASGG
SSSSVRGTSILRRSSFSEGQTLAPPGTLRRSHMRSHSDTNVASGRAHGGHRDMSIIIEDP
VAESNGDISQFKGGMSCSMQRGEVSSPGSVYVEYDTGQYLHSGEGMFRRPSEGQSLISYL
SEQDFGSCADLEKENAHFSICESLIAAIELMKCNMKNRQLEEEEEDSDKEIQELKQKIRI
RRQQIRTRNLHPAYEEIGSDSLLATDSGSHFSSRDSARLSDSGSAEEVDEYEIKDGNDGS
NLIQLSKSGLSVSMASLFSDEDIKRSSAPSRKAFHFSGSTFHSFLNSNSAEAVAMGLLKQ
FEGMQLPAASELEWLVPEHDAPQKLLPIPDSVPISPDDGEHADIYKLRIRVRGNLEWAPP
RPQIIFNIHSAPTRKVAVAKQNYRCAGCGIRTDPDYIKRMRYCEYLGKYFCQCCHENAQM
VIPSRILRKWDFSKYYVSNFSKDLLTKIWNDPLFNVQDINPGLYRKVKPLNQVRLLRIQL
YHMKNMFKTCRFAKTLLDAFDAVPGHLTEDLHLYSLNDLGATKKGELLPRLSELLRAGSL
HVEKCMLCQAKGFICEFCQNEDDIIFPFELNKCRTCEECRACYHKICFRSGPCPKCKRLQ
ARRELLAKQSMEADLSDYEDGQEEDAAGAAT
Download sequence
Identical sequences H9G6W1
XP_008118209.1.98722 ENSACAP00000002857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]