SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000003152 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000003152
Domain Number 1 Region: 387-453
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000122
Family C-terminal fragment of elongation factor SelB 0.067
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000003152
Domain Number - Region: 158-321
Classification Level Classification E-value
Superfamily TPR-like 0.000522
Family Tetratricopeptide repeat (TPR) 0.018
Further Details:      
 
Domain Number - Region: 59-111
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.034
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000003152   Gene: ENSACAG00000003160   Transcript: ENSACAT00000003233
Sequence length 523
Comment pep:known_by_projection chromosome:AnoCar2.0:6:68929981:68944676:1 gene:ENSACAG00000003160 transcript:ENSACAT00000003233 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKQEGGSRRRAGQEKAKPPPAEPPQPPPPTADVEMHEEASAAPSEPASAEKSQRELDAVT
LEDIKEHVKQLEKAVSGKEPRYVLRALRALPSTSRRLNPNVLQKAINGFFTSNSAVRDFL
ISFLEEPMDTEADLQFRPRTGKAASTPLLPEVEAYLQLLLVIHLMNSKRYQEAQKVSDDL
MQKTSLQNRRALDLVVAKCYYYHARIYEFLNKLDVVRSFLHARLRTATLRHDADGQATLL
NLLLRNYLHYDLYDQAEKLVSKSVFPEQANNNEWARYLYYTGRIKAIQLEYSEARRTMTN
ALRKAPQHTAVGFKQTVHKLLIVVELLLGEIPDRLQFRQPSLKRSLMPYFLLTQAVRTGN
LAKFNQVLDQFSDKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLDSP
EDAEFIVAKAIRDGVIEASINHEKGYIQSKEMTDIYSTREPQLAFHQRISFCLDIHNMSV
KAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDGFP
Download sequence
Identical sequences G1KBP6
ENSACAP00000003152 XP_003222495.1.98722 28377.ENSACAP00000003152 ENSACAP00000003152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]