SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000003351 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000003351
Domain Number 1 Region: 3-293
Classification Level Classification E-value
Superfamily Terpenoid synthases 4.52e-63
Family Isoprenyl diphosphate synthases 0.00000000535
Further Details:      
 
Domain Number 2 Region: 744-791
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000381
Family SH3-domain 0.0017
Further Details:      
 
Domain Number 3 Region: 372-551
Classification Level Classification E-value
Superfamily RUN domain-like 0.00000628
Family RUN domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000003351   Gene: ENSACAG00000003450   Transcript: ENSACAT00000003434
Sequence length 791
Comment pep:known_by_projection scaffold:AnoCar2.0:GL343519.1:250386:280030:1 gene:ENSACAG00000003450 transcript:ENSACAT00000003434 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DRERFVAFFPQIVKDLIEDELHQKDVSEAFSRLKEVVEYNAIGGKYNRGLTVVSAFGELA
GPEQQDPKNFQHAMVVGWCVELLQAFFLVADDIMDGSLTRRGHPCWYKKEGVGLAAVNDS
LLLESSIYRLLKRHCRGQPYYLNLLELFLQSAYQTELGQTLDLISAPPVDLDSFTEERYK
AIVKYKTAFYSFYLPVAAAMYMAGIDSEEEHSHARTILLEMGEFFQIQANYGQNDPEKVG
RVKQLYEELDLKTVFQNYEESSYQRLLGLISQHALRLPAQIFLGLAQLIYKRQKSKAGAG
PGRLPWDSMAAKEPGVPEQRKPPTSIFPLSLSARLALFAVQHSQSFGGIASNGHLWREDV
DRLSAQLREQKKALLVAVSASVDKIVAHFSTARNLVQKAQLGDSRLSPDVGYLVLSTLCP
ALWALVGDGLKPFQKDVITGQRPSSPWSVVEASAKPCPQARSLNALYWRVSRLAPLRSSQ
QRFHAFILGLLNLKQLEQWFETVKGEAVELILALYMPTAFLVLSQGLCRCWTEELLLLLQ
PLSMLTFQLDLLFEHHHLPFNVRPMPRRAITPTEPLTGSSKRLLQWGDRLTYTLIGNEAS
SKTEPGPQTMCQEMEEKQQSWWQQLTLSSGIYADSTSVSKQESFPYTQWAKLRVATDFEE
GNDHPEAVDSPESGNGKRLGWLFGANCPGASSEPDQSLPKSSRRPSRWLPPTMNVLALVM
KTVPAELLPTISWTKPGAFLSPFRAVRALCDHVGSEDNQLSFRKGDILQVLDTVDEDWLQ
CCQGDRRGLVP
Download sequence
Identical sequences H9G7J1
ENSACAP00000003351 ENSACAP00000003351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]