SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000003950 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000003950
Domain Number 1 Region: 29-148,340-646
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 7.98e-63
Family Integrin alpha N-terminal domain 0.0000439
Further Details:      
 
Domain Number 2 Region: 168-363
Classification Level Classification E-value
Superfamily vWA-like 5.63e-51
Family Integrin A (or I) domain 0.0000000859
Further Details:      
 
Domain Number 3 Region: 931-1133
Classification Level Classification E-value
Superfamily Integrin domains 8.37e-34
Family Integrin domains 0.005
Further Details:      
 
Domain Number 4 Region: 790-928
Classification Level Classification E-value
Superfamily Integrin domains 3.14e-20
Family Integrin domains 0.006
Further Details:      
 
Domain Number 5 Region: 650-788
Classification Level Classification E-value
Superfamily Integrin domains 4.81e-19
Family Integrin domains 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000003950   Gene: ENSACAG00000003947   Transcript: ENSACAT00000004042
Sequence length 1180
Comment pep:known_by_projection chromosome:AnoCar2.0:2:3554627:3627202:-1 gene:ENSACAG00000003947 transcript:ENSACAT00000004042 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTPGLPWLLLLLLLLLSQGILQNCCEAYNVGLQGAKVFSGPSSEQFGYNVQQLLNEEGK
WLLVGSPWSGYPRNRMGDVYKCALSQQGTKCSKMNLQTFASIPNVTEIKKDMNLGLTLVR
NSVTGGFLTCGPLWAQQCGSQYYATGICSEFSPSLQLMRSFSPAVQKCSSAVDVVVVCDE
SNSIYPWDAVKAFLKKFVQGLDIGPTKTQVGLIQYGNNPREVFNLNTYTNKEDAVQAMSE
TYQNGGEYTNTFRAIEYARRYAFSKESGGRPSASKVMVVVTDGESHDGSKLQEVIAKCNE
DNITRFGIAVLGYLIRNELDTKNLIKEIKGIASLPTSKYFFNVSSEAALLEEAGTLGERL
FSIEGTDQGDLFQLEMSQVGFSASYSQQKEVLMLGAVGAYEWTGTVIQESEKQATVFPND
AFEKVLQDRNQSSYLGYSVAVLTMKNTVYFVAGAPRSNYTGRVVVYQVDGRGNISIIHSQ
RGEQIGSYFGSVICSVDVNGDSITDVLLVSAPMFMNDFKKEEGKVYMFAVKNGILDKREI
LEGPEGLENTRYGSAITAISDLDLDGFNDVIVGAPLENQNAGAIYIYNGKQRTIQTRYSQ
KISGSDPAFGKQLRYFGRSIDGRSDLNGDGITDVSVGSDGNVIQLWSQSIAKVSMHISST
PKKISLLNKNTEVILQICFTATFRPANGNNQVDIRYNLTLDADLLSSRVTSRGLFKENNE
RYLQDNIIVRPMENCVEHIFNVQEPSDAVDSLSVRVDIRLKNPGSSPVLDKTSPASVTYA
IPFVKDCGGDEVCIADLVLDVQQKTNNGKQPVIINSKNKRLIFGVKLRNKKENAYNTRIQ
IVFSGNLFFASSSSPVDGTDVSCQMSTVQQFVVCQISYPVFKEAQQVSFDISFDFNLKSL
QNLAVLSFQALSASNEEDDTNNQVNLTVPLRYDAELHLTRFTSMNFYEVYSDYNVPSMVN
NFDEIGPAFNFSIKVTTGSIPVNMASLKIHIPKQTEEDNPLMYVTAVHASQDGDLSCEAQ
INPYNIGQQGYAVSFKKENFKTMKELNCKNVRCDTITCKLKDITLKAEYYVNVSARIWNG
TFAASNFQRIQLTAFAEIDAHNSALFVTGENTLSIPVTIINPDEKAEVPIGVVIGSVLVG
LLLLVALIAALWKLGFFKRKYEKMGKDVEDVDETLELTKD
Download sequence
Identical sequences G1KCG9
ENSACAP00000003950 XP_008101009.1.98722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]