SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000004113 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000004113
Domain Number 1 Region: 742-872
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.49e-31
Family Synaptotagmin-like (S variant) 0.00000253
Further Details:      
 
Domain Number 2 Region: 1458-1578
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.19e-24
Family Synaptotagmin-like (S variant) 0.0071
Further Details:      
 
Domain Number 3 Region: 32-184
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.48e-24
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0024
Further Details:      
 
Domain Number 4 Region: 575-703
Classification Level Classification E-value
Superfamily PDZ domain-like 1.97e-19
Family PDZ domain 0.000019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000004113   Gene: ENSACAG00000004122   Transcript: ENSACAT00000004210
Sequence length 1607
Comment pep:known_by_projection scaffold:AnoCar2.0:GL343341.1:798016:1124220:-1 gene:ENSACAG00000004122 transcript:ENSACAT00000004210 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSSSSSCSVGLRAPRPPAVPPPMPELPDLSHLTEEERNIILAVMDRQKEEEEKEEAML
KRLHQQFESYKEQVRKIGEESRRSQGDHKDDAPTCGICHKTKFADGCGHLCSYCRTKFCA
RCGGRVSLRSNNEDKVYRNNVSAGYGPLLEGPETVMWVCNLCRKQQEILTKSGAWFFGSG
PQQPPSQDGTLSDTATGGSSESPREKKARLQERSRSQTPLSTAAATSQEFSSGVQTDRRK
GTEASQQAMGLEQKQTSSRSRSEPPRERKKTSAAPEQNGKGGLKGERKRVPKSAPQQGEG
QTDERESKERRDGRRLEKGRSQDYSDFPPNFEEGKAIDEEKQRKEDDYHTRYRSDPNLAR
YPVKPHPEEQQMRMHAKVSKVRHERRHSDVALPHTEVEEPEVPENKLGKHPQLPATQDMK
SHPDTQRAYAIERTGDVRISVSKQLANHSSPTPRHSMVPTEHLESKNHDSFKTQSRLDPS
SAILSRKAKREKMETMLRNDSLSSDQSESVRPSPPKPHRSKRGGKKRQMSVSSSEEEGAS
TPEYTSCDDVEIESESVSEKGDLDYYWLDPATWHSRETSPISSHPVTWQPSKEGDCLIGR
VILNKRTTMPKESGALLGLKVVGGKMTELGRLGAFITKVKKGSLADVVGHLRAGDEVLEW
NGKPLPGATNEEVYNIILESKSEPQVEIIVSRPIGDIPRIPETSHPPLESSSSSFESQKM
ERPSISVISPTSPGALKDAPQVLPGQLSVKLWYDKVGHQLIVNVLQATDLPPRIDGRPRN
PYVKMYFLPDRSDKSKRRTKTVKKSLEPKWNQTFLYSHVHRRDFRERMLEITVWDQPRVQ
EEESDFLGEILIELETALLDDEPHWYKLQTHDESSLPLPQPSPFMPRRHAHGGENSSKKL
QRSQRISDSDFSDYDVEDGIGVVPSVGYRSSTRENKSTTLTVPEQQRTTHHRSRSVSPHR
GDEQGRTRSRLPNVPLQRSLDEIHQMRRSRSPTRHHDASRSPIDRRSRDMDSQYLSDQES
ELLMLPRAKRGRSAECLHTASELQPSLDRARSASTNCLRPDTSLHSPEQERHRWSPSLDR
RRPTSPRIHIQHASPEDDRTTPPLESCIPKQDTLNFLSANPEETQRHSRKVERYSNQKQT
RKVSASETERMHQPGSPMQSSPADTPFSSRRGRQLPQVPVRSGSIEQEQESYSPSSKANL
VVEERTRQMKMKMHRYNQTTGSGSSQELEREQYSKYDIQADQYRSCDNVSAKSSDSDVSD
VSAISRTSSASRLSSTSFMSEQSERPRGRISTFTPKMQGRRMGTSGRIITKSTSVSGEVY
KLEHNDGSQSDTAVGTLGTGGKKRRSSLSAKVVAMVSKRSRSTSQLSQTETGSKKLKSTI
QRSTETGMAAEMRSRMVRQPSRESNDGSINSYSSEGNLIFPGVRLGADSQFSDFLDGLGP
AQLVGRQTLATPAMGDIQIGMVDKKGQLEVEVIRARGLTQKPGSKSTPAPYVKVYLLENG
ACVAKKKTRIARKTLDPLYQQTLVFEESPHGKVLQVIVWGDYGRMDHKCFMGVAQILLEE
LDLSSVVIGWYKLFPPSSLVDSTLTPLTRRASQSSLESSTGPPCIRS
Download sequence
Identical sequences H9G8N1
ENSACAP00000004113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]