SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000004209 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000004209
Domain Number 1 Region: 33-152,344-668
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.7e-73
Family Integrin alpha N-terminal domain 0.0000806
Further Details:      
 
Domain Number 2 Region: 172-365
Classification Level Classification E-value
Superfamily vWA-like 1.81e-52
Family Integrin A (or I) domain 0.0000000353
Further Details:      
 
Domain Number 3 Region: 671-813
Classification Level Classification E-value
Superfamily Integrin domains 2.46e-25
Family Integrin domains 0.0013
Further Details:      
 
Domain Number 4 Region: 986-1153
Classification Level Classification E-value
Superfamily Integrin domains 8.37e-19
Family Integrin domains 0.0055
Further Details:      
 
Domain Number 5 Region: 816-942
Classification Level Classification E-value
Superfamily Integrin domains 2.3e-16
Family Integrin domains 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000004209   Gene: ENSACAG00000004092   Transcript: ENSACAT00000004308
Sequence length 1187
Comment pep:known_by_projection chromosome:AnoCar2.0:2:3643435:3686438:-1 gene:ENSACAG00000004092 transcript:ENSACAT00000004308 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VKPHPQPIPEKLCTFFHIIFSSFTAVLHLAVSFNVDVKDTMTFSGPVEDMFGYTVQQFEN
EEGKWVLIGSPLAGQPQKKTGDVYKCPVGRDNGLPCVKLNLPANTSIPQVAEVKENMTLG
STLVTNPKGGFLACGPLYAYKCGRLHYTTGICSNVSSNFEVVNSIAPSVQECNTQLDIVI
VLDGSNSIYPWESVTEFLNSLLQNMNIGPQQTQVGIVQYGENVTHEFNLNTYTTVEEVLV
AAKKIGQRGGTRTNTALGIDTARKEAFTEARGARRGVQKVMVVVTDGESHDNYRLGEVIQ
DCEDENIQRFSIAILGHYNRGNLSTEKLVEEIKSIASEPTEKHFFNVSDELALLTIVEAL
GERIFALEATKDQLASSFEMEMSQAGFSAHYSQDWIMLGAVGAYDWNGTVVMLKNTAALI
PRNDTFYDASSERNELLAAYLGYTVNSASVPGDVLYIAGQPRYNHTGQVIIYRMRGGDIE
ILQRLSGEQIGSYFGSVITTIDVDKDTFTDILLVGAPMYMGTEKEEQGRVYVYALNKKTF
EYQMTLEPIKQTCCSQLKHSDCTNHNKNEPCGARFGTSIAAVKDLNLDGFNDIVIGAPLE
DDHRGAVYVYHGNGNIIRKEYAQRIASGGDGEKMKFFGQSIHGEMDLNGDGLTDVTIGGL
GGAALFWSRDVAEVNVTMKFMPNKINIQKINSGMEKQRIFINATICFEVRLKSKEVTVNE
TNIQYWITLDAQRKLSRSLFTESSERKMQKNITVKGSDCVKHNFYMLDKPDFRDSIKVLL
EFNFSDPESGPILDNTLPNSIYEYIPFTKDCGSKKKCITDLQLTANATIGGNSFSPFIVK
LNNLKFWVQMLVRNKKDSAYNTRVFVQYSPNIIFVGIEKIPKDSCEFGQNITCKIGYPFL
STGEEIYFEIAFQFNVSYLLENTTIQFSVTRKHAQRPPNKHQSMQDWMTTTVQYIINVQF
FVQQQRKNLILIQKETSGDVYPNTSTAIKHFYIIEKIEYLPMPELTLQISFPHMDSAKNP
ILYLTRISYSENVRCQSSHPTDPLKIDAADSPFVVPRIQKPLKDAQILDCDSYDCIAINC
TVAPSDVTQVNISLRLWKRTFIKASIHSAEITARALLRSENSLLILKKENEKIETSIKIS
RELLPGHVPLWVILLSIFAGLLILTLLIFALWKAGFFNRPLRKKMEK
Download sequence
Identical sequences G1KCR0
ENSACAP00000004209 ENSACAP00000004209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]