SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000004741 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000004741
Domain Number 1 Region: 107-338,382-431
Classification Level Classification E-value
Superfamily MFS general substrate transporter 1.29e-48
Family LacY-like proton/sugar symporter 0.053
Further Details:      
 
Domain Number 2 Region: 551-693
Classification Level Classification E-value
Superfamily MFS general substrate transporter 3.27e-21
Family Glycerol-3-phosphate transporter 0.05
Further Details:      
 
Domain Number 3 Region: 455-534
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.00000000000157
Family Pentapeptide repeats 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000004741   Gene: ENSACAG00000004741   Transcript: ENSACAT00000004849
Sequence length 697
Comment pep:known_by_projection scaffold:AnoCar2.0:GL343392.1:395467:481574:1 gene:ENSACAG00000004741 transcript:ENSACAT00000004849 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDGHRGKMNQVSDDYRYQDGNYEGYAPNNGYYQSGEEPGQEEDAQSDATEGHDEDDEVY
EGEYQGIPHPDDLKPKKKRKSQALPDEFRDHAELIAEKMEDEEQLAHQYENIIEECSHGR
FQWILFIVLGLALMADGVEVFVVGFVLPSAEKDMCLTTSNKGMLGLIVYLGMMVGAVLWG
GLADKLGRKQCLTTLLSINATFGFLSSFVQGYGFFLFCRLISGFGIGGSLPIVFAYFSEF
LSREKRGEHLSWLCMFWMVGGLYASIMAWSIIPHYGWGFSMGTNYHFHSWRVFVVVCSLP
CIASLIALKFMPESPRFLLEIGKHDEAWMILKQIHDTNMRAKGEPERVFTVANIKTPKQI
DEFIEIQSSTGTWYQRFLVRATTTLKQVLDNVLYCLTAQYRMNTLFLAIVWFSMALSYYG
LVVWFPDMIRYYQEEAYKSREKIFYQESVKDITFNFTLENQVHKNGTYINDKFMKMKFRD
VTFEDSLFEECYFEDVTSSETFFKNCIITRTVFFNTDLYEHKFIDCTFVNSTFLEQKKGC
HLDFERDNDFLIYLVSFLGSLSVLPGNIISALLMDKIGRIKMIGGSMLISAVCCFFLFFG
NSESAMIGWQCLFCGTSIAAWNALDVITVELYPTHKRATAFGILNGICKIGAILGNSIFA
SFVGITKVVPILLASSALVGGGLLALRLPETRDQVLM
Download sequence
Identical sequences H9G9K8
XP_003226620.1.98722 XP_008117650.1.98722 ENSACAP00000004741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]