SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000005299 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000005299
Domain Number 1 Region: 64-155
Classification Level Classification E-value
Superfamily PDZ domain-like 7.49e-27
Family PDZ domain 0.0031
Further Details:      
 
Domain Number 2 Region: 148-278
Classification Level Classification E-value
Superfamily PH domain-like 7.13e-22
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000005299
Domain Number - Region: 296-424
Classification Level Classification E-value
Superfamily PH domain-like 0.000133
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000005299   Gene: ENSACAG00000005431   Transcript: ENSACAT00000005416
Sequence length 541
Comment pep:known_by_projection chromosome:AnoCar2.0:1:160760133:161150322:1 gene:ENSACAG00000005431 transcript:ENSACAT00000005416 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNVAGKPSPPPGQPDRPDSLLVPTWIKTGIALLYDEISGNAYEIRLKLTKEVLTIQKQDV
ICVSGSDHSSNHRTVKLHRQPVGGLGLSIKGGAEHKVPVVISKIFKDQAADQSGMLFIGD
AVIQVNGISVEGATHEEVVHLLRNAGDEVTITVQYLREAPSFLKXXXXSPGPSSDHSSGA
SSPLFDSGLHLNGNSTNTAPSSPSSPIANEPKYEKRWLDTLSVPLSMARISRYKAGTNKL
RSNAFEVLALDGVSTGILQYCTAQESADWLRALSTNISDLTLQNMKMANKCCSSSDQVIH
MGWVNERLQGADSPQLYKCKFLALKGSSFYIFSTPPVSTLDWVRAEKIYNLCEVLFKVHK
LWLNDDCWLQANLYLGIHQDYELEDQRPYCFSVVVGHCKSHYFNVELGSELAVWEKSFQK
AIFLDVQRTGSKTYTCSWQGESLCFTLDFALGFTCFDSKTKNVLWRFKFSQLKGSSDDGK
TRVKLLFQNTETKQIETKELEFQDLTAVLNCIHSFIAAKVASVDPLFIEGQSIARKYTYS
N
Download sequence
Identical sequences G1KE22
ENSACAP00000005299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]