SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000005371 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000005371
Domain Number 1 Region: 96-263
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.65e-43
Family Ypt/Rab-GAP domain of gyp1p 0.0043
Further Details:      
 
Domain Number 2 Region: 242-358
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 4.18e-25
Family Ypt/Rab-GAP domain of gyp1p 0.015
Further Details:      
 
Domain Number 3 Region: 477-543
Classification Level Classification E-value
Superfamily SH3-domain 8.14e-19
Family SH3-domain 0.00082
Further Details:      
 
Domain Number 4 Region: 565-596,630-717
Classification Level Classification E-value
Superfamily RUN domain-like 0.000000000119
Family RUN domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000005371   Gene: ENSACAG00000005430   Transcript: ENSACAT00000005488
Sequence length 752
Comment pep:known_by_projection chromosome:AnoCar2.0:5:25788453:25829812:1 gene:ENSACAG00000005430 transcript:ENSACAT00000005488 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGSYTPTAGGPFSALTPSIWPQDILAKYTQKEESVEQPEFRYDEFGFRVDKEDGAEPNS
SKLLGIPLTEEPQHRLKWQAHLEFTHNHDVGDLTWDKIEVTLPHSDKLRSLVLAGIPHSM
RPQLWMRLSGALQKKRSSEMSYREIVKNSSNDETIAAKQIEKDLLRTMPSNACFSNMNSI
GVPRLRRILRGLAWLYPEIGYCQGTGMVVASLLLFLEEEDAFWMMCAIIEDLVPASYFST
TLMGVQTDQRVLRHLIVQYLPRLDKLLQEHDIELSLITLHWFLTSFASVVHIKLLLRIWD
LFFYQGSIVLFQVTLGMLSMKEDELIQSENSASIFNTLSDIPSQIEDPDVLLQEAMRIAG
SLTDVAVETQRCKHLAYLIADQGQLLSPGAAVNLSKIVRRRTQRRKSGITSLLFGEDDME
ALKAKNIKQTELVADLREAILQVAQHFQCVDPKSCSIDLTPDYTMESHQRDHETYVACSR
NQRRRAKALLDFERHDDDELGFRKNDIITIISQKDEHCWVGELNGLRGWFPAKFVEVLDE
RSKEYSIAGDDSVTEGITDLVRGTLSPALKAIFEHGLKRPSLLGGACHPWLFIEEAAGRE
VERDFDSVYSRLVLCKTYRLDEDGKVLTPEELLYRAVQSVNMSHDAAHAQMDVKLRSLIC
VGLNEQVLHLWLEVLCSSLQTVEKWFHPWSFLRSPGWVQIKCELRVLSKFAFSLSQDWEL
PIKREEKEKKPLKEGVQDMLVKHHLFSWDIDG
Download sequence
Identical sequences G1KE59
ENSACAP00000005371 XP_008108940.1.98722 XP_016849204.1.98722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]