SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000005556 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000005556
Domain Number 1 Region: 563-617
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0000458
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000005556   Gene: ENSACAG00000005666   Transcript: ENSACAT00000005678
Sequence length 746
Comment pep:known_by_projection chromosome:AnoCar2.0:3:36101806:36121039:-1 gene:ENSACAG00000005666 transcript:ENSACAT00000005678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPKGGGSNPASEFSLSCRSSCQQAKNMNIDDGGATPVQDERDSGSDMEDNGNDQLSGSE
NASIGQHSENELSDGEDDSHTRGDPMTDSENEGTPRQKHSDSENEEAPNHHASDSENEGA
PISKDSDSDNEDHPVRHASDSENEDAANNQASDSESEEPTKGHDSDSETEEPQKHLASDS
ENEESHKDHTSDLENEEPEKHLGSDSENEEPEKNNDTDSENDVVPKPLVSDSENEGPKPQ
TSDSETEDVPKNKVEAESEDSSRTSKKKEETENSAEISDSDQVGKRLRDSDSEEEEESPK
KRKIADSDEEEEKEEEKSAKRKAAVLSDSEDEETTPAKKGRIISDGEESDSDNATEKYEK
QKKVLTSDSEDDDDKVDDGKKKEEKDLFGSDSESGNEQENLIADIFGESGDEEEEEFTGF
NQEDLDEEKAERKEAADDSDSDDNIKRGKHMDFMSDFEMMLQRKKSMSGKRRRNRDGGTF
ISDADDVVSAMIVKMNEAAEEDRQLNTQKKPALKKLTLLPTVVMHLKKQDLKETFIDSGV
MSAIKEWLSPLPDRSLPALKIREELLKILQELPSVSQETLKHSGIGRAVMYLYKHPKESR
PNKDMAGKLINEWSRPIFGLTSNYKGMTREEREQRDLEQMPQRRRLSSSGGQTPRRDLEK
VLTGEEKALRPGDPGFCARARVPMPSNKDYVVRPKWNVEMESSRLGTVKKGISRLEKHKR
RFAEQKRLGKMHRAVKFSIEGNRMPL
Download sequence
Identical sequences G1KEI0
ENSACAP00000005556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]