SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000006277 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000006277
Domain Number 1 Region: 89-129,312-621
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.7e-56
Family Integrin alpha N-terminal domain 0.0000338
Further Details:      
 
Domain Number 2 Region: 111-334
Classification Level Classification E-value
Superfamily vWA-like 1.78e-48
Family Integrin A (or I) domain 0.00000568
Further Details:      
 
Domain Number 3 Region: 776-919
Classification Level Classification E-value
Superfamily Integrin domains 6.8e-24
Family Integrin domains 0.0033
Further Details:      
 
Domain Number 4 Region: 621-772
Classification Level Classification E-value
Superfamily Integrin domains 2.04e-18
Family Integrin domains 0.0029
Further Details:      
 
Domain Number 5 Region: 954-1087
Classification Level Classification E-value
Superfamily Integrin domains 0.0000022
Family Integrin domains 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000006277   Gene: ENSACAG00000006162   Transcript: ENSACAT00000006417
Sequence length 1170
Comment pep:novel scaffold:AnoCar2.0:GL343220.1:2431120:2468441:-1 gene:ENSACAG00000006162 transcript:ENSACAT00000006417 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IDNIRAQLDHFTYVSTMLVPQGRGFSVDVDTPTIFPVQTQSFGASVAQTRNAWRVFVGIP
QKHMLASKGRSVCLWISGVIINISFRAGPVDAVNMSLGLSLAAHDSQVLVCGPTVHRACG
ENMYVNGYCFLLDQNLQQLQRFPETLPECTTRPTDIVFLIDGSGSINKADFERMKQFVSE
TTKRLSGRDTRFALIQFSDRYLEHFNFNSEDPEQLVLHIHQVGGWTETATAIRRVVRELF
TSQKGSRNGATRILIVITDGVKTDRLQYSQVIPEAKQAGIIRYAIGVGDAFSSPDAKREL
DDIASEPKAEHIFTVYNFNALRGIQDQLKDKIFAIEGTQSQSTSSFQMEMSQEGFSALLT
PEGPVVGAVGSYDWTGGVILYQNSNRNPSFVNISSAAKRMDNAYLGYSSQPVQLNGKISF
VVGAPRYDYVGKVVLFEKHPRHGEWQLKAEAVGEQVGSYFGATLCSVDLDQDANTDLVLV
GAPMYYDGLTGGRVYICELMAKGTKSSCDISTTLKGQVGHIFSRFGASMAEAGDITGDGW
TDVAIGAPLEGENTGALYIFAGKQTSLNPEFIQQRIGGLRFSGGLLYFGQAVSGGTDLTG
DGLKDIAVGRQGQVLLLRSRPVLDMRVSIEFQPPLIPISDFRCQSQEPVEKMASVARACF
TVSKATKDKLGESVISTQAWACLALDSEKTKNLASFSSKSPVWNAGFKIGLEQKCKDHVI
NLPSCIEDTLTPITLRLNYSLTGDPIDQAQGLQPILSKESQQIYTAQLPFEKEGSDGKCE
DVLQTSFTFSDLSTVIVGLTLELNVTASIQNHGEDSYSTTLTFSYPAGLSYRKYKTEGGG
QSSQNVVSVKCHSAPVSEEERANRTATCNVNHPIFWSGAEATFVATFDVSQGAYLGDTLR
IIAKANSENGGNITNRMIHQEDLPVKYAVYIVVTTIEESTKYVNFTAGQEDTRKSVEHRY
EVRNLRQRSIPFSVTFQIPVKWKGIQVWDVSQVIPSEPQITNCILENETAGSQDFPSRED
HPVLDCSVASCKIIRCDIQMLGFQKTPLEFRIKGNVSFQWTSQIQQKKVTLVSLAKISYD
DKKYSQKEGFIQTKVQTVVERIEHYNFLPVIIGSTVGGLVLLALIVAALYKVGFFKRQYK
HMLSEAEPGNEAAETIDPTPQSTDSPPPDT
Download sequence
Identical sequences H9GBD9
ENSACAP00000006277 ENSACAP00000006277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]