SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000006502 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000006502
Domain Number 1 Region: 21-131,319-623
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 7.46e-62
Family Integrin alpha N-terminal domain 0.0000513
Further Details:      
 
Domain Number 2 Region: 113-341
Classification Level Classification E-value
Superfamily vWA-like 6.04e-45
Family Integrin A (or I) domain 0.00000166
Further Details:      
 
Domain Number 3 Region: 623-778
Classification Level Classification E-value
Superfamily Integrin domains 6.8e-25
Family Integrin domains 0.0049
Further Details:      
 
Domain Number 4 Region: 780-920
Classification Level Classification E-value
Superfamily Integrin domains 5.75e-23
Family Integrin domains 0.0026
Further Details:      
 
Domain Number 5 Region: 954-1088
Classification Level Classification E-value
Superfamily Integrin domains 0.0000000000942
Family Integrin domains 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000006502   Gene: ENSACAG00000006445   Transcript: ENSACAT00000006647
Sequence length 1168
Comment pep:novel scaffold:AnoCar2.0:GL343220.1:2388207:2422669:1 gene:ENSACAG00000006445 transcript:ENSACAT00000006647 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSLPLLICVGAVVLTSCRGFSLDTENPIIFRENAKGFGQTVVQFGSGVNAGVFVGAPLQ
PGDVDETGKLYKCQPTQSKTGGCEAVVLQRPADAVNMSLSLSLSAQDSQLLVCGPTVQQT
CGENIYLKGYCFLLDQNLAEVKRFPESLPECPKQPTDIVLLIDGSGSIQPNQFSEMKTFI
SMIMKRFQNTNTQFALSQYARWYREEFTFLDFQRVRNPDELLRPVTQLRGATLTATYIQR
VVREQFVTEKGSRPGASKVLIVITDGEKSGDPLQYSDVIPEAERAGIIRFAIGVGKAFSG
GTAKQELISIASQPEDDHVFPVDNFDALKDIQNKLQDKIFAIEGTQSKDSSSFQLEMSQE
GFSALLTPDGPALGAVGAYDWSGGVFLYGSGGESSFINMSRFSKEMDDAYLGYSLQTIRL
NGQSSYVLGAPRYQHAGKVVWFSQENGQWKVKSELSTKEPIQIGSYFGAALCSVDLDRDT
NTDLVLIGAPMYYDTMAGGRVYICERKGESFLCSKELHGETNNPFGRFGASIAEIGEISG
DRWTDVAVGAPMEDENRGTVYIFRGSRRSINQEYSQRIRSSQFANNLQYFGQAIGAGSDL
TGDGLPDVAVGAEGQVLLLRSRPVLQVHSRITFEPSIIPLSAFECKDQGVLNKEISKATV
CLAVKSDPRFTLSNSISSTIRYTLALDYGRSMIRAVFQGGSSTSTITEELQVDLRENCKD
YRIKLPTCIEDSLTPLSLRLNYTLTGDPIQGSNNLRAILGEDEPRQFTEYLPFEKNCGRD
GVCKDELKTSFNFSGLDTLVVGVTTEVNATVFIRNDGEDSYSTTLNFLYPSALSYRRFTL
LKSNRLFAVIKCGSVPAAEDDPVGNSTCSINHPIFRSGAEVIFIATFSISQNADLGLEVQ
INATAGSENSGLITQDMIHQEKLPVKYAVYIFVNAIDKSTKYVNFSVGQENQNRTVEHIY
EVKNTYQRKVNVSVVFQFPVELSETWVWNASLEFPKELSHLANCVPGKQTPGSKDFVKQL
SKRPILDCSVATCKTVHCRIPSLEQQQPLQFTIKGDTGLKWLSQTQQKKVTLVSSAQIFY
DENKYTTKKEFVQSQANTVLEHLVPYNYLPIIIGSSIGGLVLLALIIAALYKLGFFKRQY
KAMMDEAGDVGNEAAGPSQDPTPPATKG
Download sequence
Identical sequences H9GBR0
XP_008113686.1.98722 ENSACAP00000006502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]