SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000008638 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000008638
Domain Number 1 Region: 426-694
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 4.15e-108
Family N-acetyl transferase, NAT 0.00000000116
Further Details:      
 
Domain Number 2 Region: 255-325
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.44e-17
Family PHD domain 0.005
Further Details:      
 
Domain Number 3 Region: 101-178
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000034
Family Linker histone H1/H5 0.03
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000008638
Domain Number - Region: 201-269
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000554
Family PHD domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000008638   Gene: ENSACAG00000008709   Transcript: ENSACAT00000008821
Sequence length 1732
Comment pep:known_by_projection scaffold:AnoCar2.0:GL343196.1:2267250:2374741:1 gene:ENSACAG00000008709 transcript:ENSACAT00000008821 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKLANPLYTEWILEAIQKVKRQKQRPSEERICHAVCVSHGLDKKSVSEQLELSVQDGSV
LKVTNKGLASYKDPDNPGRFLPVKVCDLSKPSKGSKGTCSELRNVDWNKLLRRGIEGLQE
PNGSSLKNIEKYLRSQHDLAGIFNDPVFQRRLRLGAKRAVNNGRLLKEGPQYRVNYGILE
GRGTSRYSSFPISLPPVSLLPHEKDQPRADPIPICSFCLGTKESNREKKPEELLSCADCG
SSGHPSCLKFCLELTTNVKALRWQCIECKTCSACRIQGKNADNMLFCDSCDRGFHMECCD
PPLSRMPKGMWICQVCRPKKKGGKLLHEKASQIRRRYAKPIGRPKNKVKQQMLSVTSDEG
SMNAFTGRGSPGTEIKISIKQENADLFLVGSKDFVTEEDLEIYKQAQELAMEKIGCKIGG
ETNGRYPSVIEFGKYEIQTWYSSPYPQEYARLSKLFLCEFCLKYMKSKNILLRHSKKCGW
FHPPASEIYRRKDLSVFEVDGNASKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTKND
EKGCHLVGYFSKEKLCQQKYNVSCIMIMPQYQRQGFGRFLIDFSYLLSRREGQAGSPEKP
LSDLGRVSYLAYWKSVVLEYLYCHHEKQISIKGMSRATGMCPHDIATTLQQHRMIDRREE
KFVVIKREKLISSHMEKLKTNPRINEVDPESLRWTPLLVPNAAVSEEEREAEKEAERLME
QASCWEKEEQELFSKRANRQLSAKVQSKNKYLRPTENVSAIAEKGQATDPPKESSGDEEE
EEEEEEEEEIMDGHHQNSSPRLAKLQLLAMKRKRSFVLKKKRGRKRRKINSSVTTETISE
TTEVLNEPFDNLEEERPMPQGESTFEIDGESDELKAGIQEVFQSPSEEREENEQEKEEQE
KDNHSYQNDTAYRAKAEDSAAILEDVSKDNPEPVVCKQAWPKGMKHYPSKWRQSKERKFG
FKLNLYTPPETPMEPDYQLMGEESKEPAESNPSQDSAVTEEVKNSETILPCEDEAGDSAS
EYLELSRTEKTENDLEEVEENNTVEEVESVNSQSKNQQETTEMEKEEPEPLDHDEEEEEG
KSRNEDHDADDEDESHVCSAEIETQEAAPEEPLKEVLENQESFLGEHEHSVKSSQEDAID
CTVDLVNECNSDQKEFPAVLESASEPSNENTEDQNQVENAELNSAFKNTNTETLEIDSET
AQAVKSLTQETAEHEDAFQDSAETQEACQSLQTYTNTNESPQISTLDDCQQSDHSSPVSS
VQSHPSQSVRSANSPNVPPLENSYTQISPDQSAISVPSLQNMETSPMMDVPSVSDHSQQV
VDSGFSDLGSIESTTENYENPSSYDSTMGNSICTNNSSQNSCSYSNLTSTSMTQSSCAVT
QQMSNMNGSCSMMQNTSINSPPPCNVKSPQGCVIERPPSSNQQLPQCSMAANFSPPMQLS
EIAETGNANIGLYERMGQGEFAAGHYPQPSATFSLAKLQQLTNTLMDHSLPYSHSAAVTS
YANSASLSAPLSSTGLVQLSQSPHPVPVGGQVQTTMTPPPNLTPPPMNLPPPLLQRNMAT
SNIGLSHAQRLQTQMPGKGHVSGRTKSAPLPPAAASHQPQIYGRASQTVAMQGPARALTM
QRGMNMSVNLMPAPAYNVNSVNMNMNTLNAMNGYSMSQPIMNGGYHANHGYMNQTAQYPM
QMQMGMMGSQPYAQQPMQTTPHSNMMYTPPAHHGYINTGMSKQSLNSTYMRR
Download sequence
Identical sequences H9GEE3
XP_008112489.1.98722 28377.ENSACAP00000008638 ENSACAP00000008638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]