SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000008660 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSACAP00000008660
Domain Number - Region: 177-284
Classification Level Classification E-value
Superfamily Tropomyosin 0.00621
Family Tropomyosin 0.0031
Further Details:      
 
Domain Number - Region: 290-333
Classification Level Classification E-value
Superfamily Delta-sleep-inducing peptide immunoreactive peptide 0.00837
Family Delta-sleep-inducing peptide immunoreactive peptide 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000008660   Gene: ENSACAG00000008853   Transcript: ENSACAT00000008845
Sequence length 346
Comment pep:known_by_projection scaffold:AnoCar2.0:GL343213.1:338618:371877:-1 gene:ENSACAG00000008853 transcript:ENSACAT00000008845 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSCEKTKRLPTRIVTTTLVVKQHIVRKDRGTEGSYLQNGRTVSDITEETEYIKQIRSTLA
KVQPLLCKNESRHGVANHMLDSKLHFQDPELEPDERSLSFSYKETVDKTEKAEEELSRVN
KENELLKIKLEASRAAGAESLKYASQQLHEDYRKRSEDLKKRQEGTIHIMKARKLEQEQK
LKQSTDNLSQLNVQLQEKQSQIEELEKRIQRMEEEKKKLNEKKGVLKEKLHQMMSNAENT
KSCAGVQTEMSTLQEQISHLDNLIHFQHQHLHGVIQQMEELNNELMLQDEKIESLKETIE
TLQAKNKELKYKVEFYSSQSKPKVSKAVSARLDAGLPYTMISRLRR
Download sequence
Identical sequences H9GEF6
XP_003223703.2.98722 ENSACAP00000008660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]