SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000008855 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSACAP00000008855
Domain Number - Region: 28-68
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.00221
Family Transcriptional factor domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000008855   Gene: ENSACAG00000009057   Transcript: ENSACAT00000009046
Sequence length 112
Comment pep:known_by_projection chromosome:AnoCar2.0:1:93752461:93765926:-1 gene:ENSACAG00000009057 transcript:ENSACAT00000009046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCGGCVKTEYPSRGNTCLENGSYLLNYVGCTECKKRDFVMIINRAREEEDGEEIITYDHV
CKNCHHVIARHEYTFSVVDDYQEYTMLCMLCGRAEDSISVLPDDPHLMTPLF
Download sequence
Identical sequences G1KIE2
XP_008109847.1.98722 ENSACAP00000008855 ENSACAP00000008855 28377.ENSACAP00000008855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]