SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000008942 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000008942
Domain Number 1 Region: 41-469
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.96e-75
Family Integrin alpha N-terminal domain 0.00000118
Further Details:      
 
Domain Number 2 Region: 471-628
Classification Level Classification E-value
Superfamily Integrin domains 9.42e-29
Family Integrin domains 0.001
Further Details:      
 
Domain Number 3 Region: 632-773
Classification Level Classification E-value
Superfamily Integrin domains 7.32e-25
Family Integrin domains 0.0044
Further Details:      
 
Domain Number 4 Region: 780-949
Classification Level Classification E-value
Superfamily Integrin domains 0.0000000000000034
Family Integrin domains 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000008942   Gene: ENSACAG00000008954   Transcript: ENSACAT00000009133
Sequence length 1040
Comment pep:known_by_projection scaffold:AnoCar2.0:GL343455.1:592230:641495:1 gene:ENSACAG00000008954 transcript:ENSACAT00000009133 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAPWQQQKQQAAKEAPFLSPPGLARLLLSLSCCSTAAQAYNLDTLSPLVFQGDNGTLFG
YSVLLHSVGRSPWLVVGAPKANWSTNTSVVSPGAIYRCQIGKNPERSCEALQVGDPEGQK
CGKTCLEERDNQWLGVSLSRQPGEDGSIVACGHRWKNVFYISEHKLPNGVCYVIPANFRT
LLSQRICPCYKDYVRRYGEKYGSCQAGIATFYTKDLIIMGAPGSDYWTGSIFVYNKTANI
YISYVDDSQVKSGSYLGYAVGAGHFLSPSSTEVIGGAPQQEQTGKAYIFKIQPRRLSILT
ELKGKKLGSYFGSTVCAVDLNGDGFSDLLVGAPTYSKVREEGRAYVYINSGSGAKMTELE
TALVGSDLYAARFGESIANLGDIDNDGFEDVAIGAPQENDLEGAIYIYNGRKNGISPVFS
QRIRGHQISNSLRMFGQSISGKIDVDSNGYSDVAVGAFLSDSAVLLRTRTVVIVEASLKH
PDSVNRTKLDCVLNGQPAVCVNLNLCFNYSGRTVPGYIVLLYNLSLDGGRRPDTAARFYF
SSNGTSETTSGSIKIYNSNNNTCTILQAFMRKDVRDILAPIHVEATYRLGNHVLKGESTD
ELSPLQPVLQQRKDDDIIHSKFVFARFCSQENCSANLQVSGKLAFPRPHEKKSYLSVGNM
KTLMLNVTLYNSGDDAYQATLHIQLPKGLYFTKILDQEETQINCEVSEKEDHAVRLDCSV
GYLYVDHLSKMDFTFVLDASSLSRAGDDLTISINTTCENEVSSNLLLDNSLTLILPQKHE
VELNAHGSVTPTSFVYGPSEENPPVTCMKEMFNFTFHVSNPGLSLAPAVDLMIQIPNSFV
PSDVKLFNILDVKTTVGQCIYQNHTRDCTLPEKSENMLQEFIMFLTKLDKRLLYCMKNDP
FCLQILCNFGDMESGKEATVQIHLEATPSLLEMGEASTLIFEIKGKVSADQSPKVIELYK
SRQTAYVILEGLHNQKTKKSVTLLFIGMGSIVGILLLLVLAFLLWKVGFFKRKYKHLPQE
QNGRESWSFINSDPNDATDE
Download sequence
Identical sequences H9GEU4
ENSACAP00000008942 XP_003227172.1.98722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]