SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000009102 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000009102
Domain Number 1 Region: 39-621
Classification Level Classification E-value
Superfamily Prokaryotic type I DNA topoisomerase 4.05e-162
Family Prokaryotic type I DNA topoisomerase 0.0000152
Further Details:      
 
Domain Number 2 Region: 650-692
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.0000151
Family PhnA zinc-binding domain 0.052
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000009102
Domain Number - Region: 962-995
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000366
Family Retrovirus zinc finger-like domains 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000009102   Gene: ENSACAG00000009174   Transcript: ENSACAT00000009295
Sequence length 997
Comment pep:known_by_projection scaffold:AnoCar2.0:GL343618.1:177099:191446:-1 gene:ENSACAG00000009174 transcript:ENSACAT00000009295 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIPSSLLFVRRGVRLISRSWKRCFCQSAEGDMTFRNIQKVLCVAEKNDAARGIADILSNS
RMRRREGFSKFNKIYECQYHLLGQNVTVVMTSVSGHLLAHDFKLPFRKWHSCNPLVLFDA
EIEKFCPENYLDIKRTLEREVQQCQALVIWTDCDREGENIGFEVIDVCKAVKPSLQVFRA
RFSEITPRAIKTACENLTQPDQNVNDAVDVRQELDLRIGAAFTRFQTMRLQKIFPEVLAE
QLISYGSCQFPTLGFVVERFKAIQAFVAETFYKIKVTHDHEEGTVDFSWKRNRLFNHTAC
LILYQMCMEDPLATVVEVGSRPKSKWRPLPLDTVELEKLASRKLKINAKETMKIAEKLYT
QGYISYPRTETNIFPKDLNLPNLVQLQTLDPRWGAFAQRILDQGGPTPRSGTKSDQAHPP
IHPTKHATNLQGNDQRLYEFIVRHFLACCSQDAKGQETTVEIDVANERFVAHGLMILARN
YLEVYPYEKWSDKVIPVYEKGSRFQPSTVEMVEGETSPPQLLTEADLISLMEKHGIGTDA
THAEHIETIKSRMYVGLTPDQRFVPGELGMGLVEGYDSMGYEMSKPDLRAELEHDLKLIC
EGKKGKAVVLREQVQKYKRVFIEAVQKAKKLDEALAQYFGQGAPLTQEEEIYPALPDPVR
KCPQCNSDMVLKTKKSGGFYLSCLGYPSCKSAVWFPDSVLEVSKDDSVCDVCRPHPVHRL
KLKFKRGGLPPMMPLEFVGCIGGCDETLREVLDLRYLQGPPRPASQPANRLVSPLQANHS
LNHMTGNSNNHQGVSAPPSRPNRTAASEDNNAVVCNCGEEALFLTVRKEGPNQGRQFYKC
RSGGCGFFLWADQQPDSAVSNVPSGFGPFDPSQRGERGAARSWSEGGGGGGTAVCKCGQP
AITRTVQREGANKGRQFHTCAKPREQQCGFFQWTDENVVPGFPSSHFTGEGTTRGLGTKT
KRSDSDPGLRAPTTKRSRTCGVCHQPGHTRKTCPQNR
Download sequence
Identical sequences H9GF12
XP_008120111.1.98722 ENSACAP00000009102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]