SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000009428 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000009428
Domain Number 1 Region: 623-753
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.21e-32
Family Synaptotagmin-like (S variant) 0.00000087
Further Details:      
 
Domain Number 2 Region: 1255-1375
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.46e-23
Family Synaptotagmin-like (S variant) 0.0075
Further Details:      
 
Domain Number 3 Region: 456-577
Classification Level Classification E-value
Superfamily PDZ domain-like 4.39e-20
Family PDZ domain 0.00000167
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000009428
Domain Number - Region: 1-29
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000863
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000009428   Gene: ENSACAG00000009511   Transcript: ENSACAT00000009625
Sequence length 1404
Comment pep:known_by_projection chromosome:AnoCar2.0:4:13195324:13591666:-1 gene:ENSACAG00000009511 transcript:ENSACAT00000009625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWVCNSCRKQQEILTKSGAWFYNSGTNTPQKSDQDVFRGLRNEEAPQEKKAKLQEQSISA
LERGRSQGLTRQESINGSGGKVAGDTADRKRSPSISRDQNRRFNQLEERDDYSQYATSDS
AMPRSPSDYADRRLQHGTQLYEEPELDDYRDSNRRSRRRSREYPLEEDEIQNREDYERQR
REEEYQARYRSDPNLARYPVKPQPYEEQMRIHAEVSRARHERRHSDVSLANTELEDSRLS
MMRMERPSRQRSASERRAAMDQRSYSMERTQGLSPNRQRTTNHSPPTPRRSPIPFDRPEM
RRTDSLRKQHHLDPSSAVRKTKREKMETMLRNDSLSSDQSESVRPPPPKPHKTKKGGKMR
QVSLSSSEEELASTPEYTSCDDVEIESESVSEKGDSQRGKRKTSEQAVLSDSNTLSERQK
KMVYFGGHSLEEDLEWSEPQIKDSGVDTCSSTTLNEEHSHSEKHPVTWQPSKDGDRLIGR
ILLNKRLKDGSVPRDSGAMLGLKVVGGKMTESGRLCAFITKVKKGSLADTVGHLRPGDEV
LEWNGRLLQGATFEEVYNIILESKPEPQVELVVSRPIGDIPRIPDSTHAQLESSSSSFES
QKMDRPSISVTSPMSPGMLRDVPQFLSGQLSIKLWYDKVGHQLIVTILGAKDLPSREDGR
PRNPYVKIYFLPDRSDKNKRRTKTVKKTLEPKWNQTFIYSPVHRREFRERMLEITLWDQA
RVREEESEFLGEILIELETALLDDEPHWYKLQTHDVSSLPLPHPSPYLPRRQLHGESPTR
RLQRSKRISDSEVSDYDCDDGIGVVSDYRQNGRDLQSSTLSVPEQVMSSNHCTRSGSPHR
GDSIGRTRSWSPSVPPVQSRNVEQGSRGPRSTPAHYNTMNRMDRHRIMDDHSSPDRESDR
KWEPRLPYQRSRSTEQRPVLERPSPRSRSTERPDSNLMRSMPSLMTGRSAPPSPALSRSH
ARMGSVQTSPSSTPVAGRRGRQLPQLPPKGTLERSAMDTEERNRQMNMNKYKQVAGSDSR
LEQDYHSKYRSGRDPQRGSDNISTKSSDSDVSDVSAVSRTSSASRFSSTSFMSVQSERPR
GNKKISVFTSKMQSRQMGVTGQNITKSTSISGEMYTIEKNDGSQSDTAVGTVGTGGKKRR
SSIGAKMVAIVGLSRKSRSTSQLSQTEAGGKKLKSTVQRSTETGLAVEMRNWMTRQASRE
STDGSMNSYSSEGNLIFPGVRLAADSQFSDFLDGLGPAQLVGRQTLAAPAMGDIQVGMMD
KKGQLEVEIIRARGLVVKPGSKTLPAPYVKVYLLENGVCIAKKKTKVARKTLEPLYQQLL
SFEESPQGKVLQIIVWGDYGRMDHKSFMGVAQILLDELDLSNMVIGWFKLFPPSSLVDPT
LAPLTRRASQSSLESSTGPSFARS
Download sequence
Identical sequences G1KJ45
ENSACAP00000009428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]