SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000009486 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000009486
Domain Number 1 Region: 748-824
Classification Level Classification E-value
Superfamily RUN domain-like 0.00000000275
Family RUN domain 0.017
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000009486
Domain Number - Region: 636-707
Classification Level Classification E-value
Superfamily SAICAR synthase-like 0.0314
Family Inositol polyphosphate kinase (IPK) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000009486   Gene: ENSACAG00000009569   Transcript: ENSACAT00000009683
Sequence length 850
Comment pep:novel chromosome:AnoCar2.0:1:64294654:64353998:1 gene:ENSACAG00000009569 transcript:ENSACAT00000009683 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSSSSSSPSAPGRFADYFVICGLDTGTGLEPDELSALCQYIQASKAQDGGGRFISSTAEG
ENFEQTPLKRTFKSKVLAHYPENVEWNPFDQDAVGMLCMPKGLSFKTQADAREPQFHSFI
ITREDGSRTFGFSLTFYEEVTSKQICSAMQTLYHMHNAEYDILHTPPTNHKDNCSTIEDC
NGSSISKLQRFNSYDISRDTLYVSKCICLITPMSFMKACRKALEQLHQAVTSPQPPPLPL
ESFIYNILYEVPLPPAGRSLKFSGVYGPIICQRPSTNELPLFDFPVKEVFELLGVENMIQ
LFTCALLEFQILLYSQHYQRLMTVAETITALMFPFQWQHVYVPILPASLLHFLDAPVPYL
MGLHSNGLDDRSKLELPQEANLCFVDIDNHYVELPEDLPQFPNKLEFIQEVSEVLMGFGI
SPEGNLHCSEIASKMKSLRTCDIVSDKRNGNIGGTTLNSYELLKENETIARLQALVKRTG
VSLEKVEVREEIGVKKNLKVQCDEEEFKVYQLNIQIREVFANRFTQMFADYEVFVIQPSQ
DKESWFTNREQMQNFDKASFLSDQPEPYLPFLSRFLETQMFASFIDNKIMCHDDDDKDPV
LRVFDSRVDKIRLLNVRTPTLRTSMYQKCTTIDEAEKAIELRLAKIDHTAIHPHLLDMKI
GQGKYEPGFFPKLQSDVLSTGPTSNKWTKRNAPAQWRRKDRQKQHTEHLRLDNDQREKYI
QEARNLGSSIRQPKLSNLSPSVIAQTNWKFVEGLLKECRNKTKRMLVEKMGREAVELGHG
EVNITGVEENTLIASLCDLLERIWSHGLQVKQGKSALWSHLLHYQENRQRKPTSGSFSTS
GTVGFYRVYK
Download sequence
Identical sequences G1KJ69
ENSACAP00000009486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]