SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000009988 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000009988
Domain Number 1 Region: 56-226
Classification Level Classification E-value
Superfamily vWA-like 1.03e-17
Family Integrin A (or I) domain 0.05
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000009988
Domain Number - Region: 276-312
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.0816
Family PhnA zinc-binding domain 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000009988   Gene: ENSACAG00000010109   Transcript: ENSACAT00000010194
Sequence length 392
Comment pep:novel chromosome:AnoCar2.0:2:16892487:16947416:-1 gene:ENSACAG00000010109 transcript:ENSACAT00000010194 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEEHERTKRWEGGYERTWEVLKEDESGSLKASVEDILFKAKRKRVFEHHGQVRLGMMRH
LYVVVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQVGIIITKGKRAEKLTEL
AGNPRKHITALKKAVDMTCAGEPSLYNALNLATQTLKHMPGHTSREVLVIFSSLTTCDPS
NIYDLIKSLKMLKIRVSVIGLSAEVRVCTVLARETGGTYHVILDESHYRELLMHHVSPPP
ATSGSESSLIRMGFPQHTIASLTDQDAKPSFSMAHLENSSEPGLTLGGYFCPQCRAKYSE
LPVECKVCGLTLVSAPHLARSYHHLFPLDAFQEVPLEEYTGERYCQGCHGGIGDQHVSFP
FSAALLSSFVPSALPAGRRSDRLCSSRFPYPV
Download sequence
Identical sequences G1KJT6
ENSACAP00000009988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]