SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000010090 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000010090
Domain Number 1 Region: 46-210
Classification Level Classification E-value
Superfamily RUN domain-like 3.79e-49
Family RUN domain 0.000000164
Further Details:      
 
Domain Number 2 Region: 573-639
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 3.45e-21
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000010090   Gene: ENSACAG00000010193   Transcript: ENSACAT00000010297
Sequence length 643
Comment pep:known_by_projection scaffold:AnoCar2.0:GL343215.1:1526247:1551938:-1 gene:ENSACAG00000010193 transcript:ENSACAT00000010297 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTVKICTWVSSFDRSLLMAYLQKEKGGRKEGRKEGRKEAAKDPTAVERANLLNMAKLSIK
GLIESALSFGRTLDSDYPPLQQFFVVMEHCLKHGLKVKKSFLSYNKTIWGPLELVEKLYP
EAEEIAASVRDLPGLKTSLGRARAWLRLALMQKKMADYLRCLIFRKDLLSEFYENHALMM
EEEGVVIVGLLVGLNVIDANLCVKGEDLDSQVGVIEFSMYLKNEDDIESKERNDHIAAIL
DQKNYVEELNRQLNSTVGGLHTRVDSLEKSNTKLIEELAIAKNNIIKLQEENHHLRSENT
LILMKTQRHLEVNKVDTDAELQTYKHSRQSLDEMYNEAHRQLREESQLRQDIENELMVQV
GMKHEIELAMKLLEKDIHEKQDTLISLRQQLEEVKAINVEMYQKIKVSDEDMKEKNEIIG
RLEDKTNQINTTMKQLEQRLQQTEKSQTEAESEDKKFKQDYMSKSESLQKEITQKEKQVC
QLETDLKIEKEWRQTMEEDLRKEKEMASSLKTETQQIITLKKEFLKLQEKNKQLRNLCHD
QEEALQELAGKLSESKLKIEDIKEANKALQGQVWLKDKDATHCKLCEAEFSLSRRKHHCR
NCGEIFCNACSDNELPLPSSPKPVRVCDTCHALLIQRCSSNVP
Download sequence
Identical sequences H9GG83
ENSACAP00000010090 ENSACAP00000010090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]