SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000010091 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000010091
Domain Number 1 Region: 22-461
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 9.68e-74
Family Integrin alpha N-terminal domain 0.00000303
Further Details:      
 
Domain Number 2 Region: 792-1020
Classification Level Classification E-value
Superfamily Integrin domains 2.14e-48
Family Integrin domains 0.00067
Further Details:      
 
Domain Number 3 Region: 461-627
Classification Level Classification E-value
Superfamily Integrin domains 2.25e-31
Family Integrin domains 0.0016
Further Details:      
 
Domain Number 4 Region: 628-786
Classification Level Classification E-value
Superfamily Integrin domains 1.15e-25
Family Integrin domains 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000010091   Gene: ENSACAG00000010030   Transcript: ENSACAT00000010298
Sequence length 1076
Comment pep:known_by_projection scaffold:AnoCar2.0:GL343198.1:1937702:2010926:1 gene:ENSACAG00000010030 transcript:ENSACAT00000010298 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGALHFSLLCFSLHFLGSSAFNLDITETILKYGDNGSFFGFSVALHQQLRPQPVSWLLV
GAPQAAALQGQKANRTGGLYACPLTHETNDCKRLTIDEGVDLKKESKENQWLGVTVKSQG
PGGKIVTCAHLYEARNRVNEPLETRDVIGRCYVLSEGLEVSDEFDGGEWKFCEGRPQGHD
RFGFCQQGMATGFTADRHYILFGAPGTYNWKGILFVTNIDSSDPDQLVYKTPEPSERVPG
SVGDVAQNSYLGFSLDSGVGIIRRNELSFVTGAPRANHTGAVVILKRDNVNRLVPEVILE
GEKLTSSFGYSVAVVDLNNDGWMDLVVGAPNLFDRKEGIGGAVYVYINQAERLKNVIPVR
LNGSYDSMFGITVGAVGDLNQDGFQDFAVGAPLDGDGKVYIYHGSNLGFVTKPAQILTGE
SVGIKMFGYSFSGGLDIDGNMYPDLLVGSLSDTVVLYRSRPVIHISRNITVTPQNVDLEN
MNCRYFEGICVDVKACFSYTANPPSYSPPITLEYTFDADADHQELRRTPRVTFRNRKTSD
PEHQYSGTVQLPQQHVRSCTKATMQLKDHVRDKLRPIVVLVSYNIKHTRSRRQTPGATLG
ALSPVLNALPPNSQRTEVNFLKQGCGEDKICQSNLQLSHRFSSRIDDSLFHPLPRGDDGL
DIFSMTDQKVVALEIFITNFPSDPDNPQQDGDDAHEAMLLVFLPPTLPYSAVRPFNASGK
TPACVSNQNASYVECELGNPMKRGAQFRFYLVLSTSGITLETEELEVGLELSTTSEQPGL
APVIARARVVMELPLSVTGMVEPQQLFYSGEVRGESAMTKESEVGSPVRYQVMVTNRGQS
LNTLGSAFLNLMWPHEIANGKWLLYPLKLELEVSTQPQKRTTCSPEPNPLRLALEYSHQS
RKKREAQQTEAPSRPLTYWERRKNATLDCAQGTARCQLFQCPLHSFDRSAVLTIWGRLWN
STFLEEYSDVTSVEVIVRASITVKSTIRNLILKDATAQIPVTVYLDPIVALARGIPWWII
LIAVLAGILVLGLLVSILWKCGFFKRTSRVSKYSTNYYRARLAIQPSDADRQAMEA
Download sequence
Identical sequences H9GG84
ENSACAP00000010091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]