SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000010387 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000010387
Domain Number 1 Region: 332-638
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 6.54e-45
Family Integrin alpha N-terminal domain 0.0000318
Further Details:      
 
Domain Number 2 Region: 134-359
Classification Level Classification E-value
Superfamily vWA-like 6.16e-40
Family Integrin A (or I) domain 0.00013
Further Details:      
 
Domain Number 3 Region: 790-929
Classification Level Classification E-value
Superfamily Integrin domains 1.94e-17
Family Integrin domains 0.0033
Further Details:      
 
Domain Number 4 Region: 638-789
Classification Level Classification E-value
Superfamily Integrin domains 0.0000000000000022
Family Integrin domains 0.0091
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000010387
Domain Number - Region: 965-1094
Classification Level Classification E-value
Superfamily Integrin domains 0.00235
Family Integrin domains 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000010387   Gene: ENSACAG00000010509   Transcript: ENSACAT00000010601
Sequence length 1176
Comment pep:novel scaffold:AnoCar2.0:GL343516.1:357601:389538:1 gene:ENSACAG00000010509 transcript:ENSACAT00000010601 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTESHRGREVTGSMGHTSGKRWALQVAFLLCFGPGFLPSSRALCFNIIDTDTPMIFPGD
KANQFGYRVVPVRASGASWLLVSAPFSENHTGSLFRCSYHTEMCQRIDLNHHSGISLGLS
LTADEETHSKIIACGPTWERRCGDINSLNGICYIMSNADQELKEIHPAAQECFNGVDAAI
LYDDSYSIRDENGDFSTMIDFLVKLMDSVREKDVQFAVVQYSTEHNLIFDFAMYNESRDK
VNKTIHSFQRHKEKTFTPSAIRYVAEEIFTSRHGMRPDSKKILIVLTDGNSNDINTAFET
ANVAADRKNITRYAIGVGKEISKDELHTIASSGENVFQAENFNALHTLQRELQNKVFGIE
GTSKNVTFSSFQKEFSQGGFSTLLTAEHVVSGTVGTYEWSGGLEEEVLTGPPQINFMNVS
DKSSLYSYLGYSMALAHHGQRMFYIVGAPRYEHIGKVFAFEKQSRMLVGSVGGDQIGSYF
GAELSVVDLNGNGHTDLILIGVPFYYNGTQGGLVEVCAFNETGGLSRLQILRGLPGNAFG
RFGSALSSLGDITGDGLADVAVGAPLEGEEERGAIYIFLGEVGRLRDVHSQCIAAASLSP
VLHFFGQSIQGRLDLSGDELTDLAVGALGSAVILRSRPVFTVILSLSFSPSLIPLDDPSC
GSGKHLGIGPRGNLSICFTLKPISPVSDILRATITYSVQSDAAQSMPRLTFENESPTIRK
DIRLGRMTRCIKESLQAPACLDDTFSPVVLKANFSGEGSPDTRELRPIIHPETNFSAEIE
VPFKQDCGPDEICVSDLRVSFNFSGSRGLNLSPKFILNLTVKLENVGETAYEPGLSFYYP
PVLSFQGASVLQSNWRLSPACQMHGSQGNSSTRHSSCSFRPPTLKKGIQAFLKFSFRSSR
RDSWHDKFASVTIRAHSQNENDTRTLSDNEATGSLPVLHPVNVIIKGVESTTYLNFSTEI
PQRKTLTHTYVVQNDGPNSTPVNVTFELSSETKLGFFWNVTLTHSNMTDKFCTPLITPRM
QLKTKKIKGPIKRGCPETATCTRFLCRFTSLSPEEKVNFSFSGEFYRKEDTSKLDSQKFH
LLSEASVFVDETRFFQIHLGKFNFSQISTEVELISPFNPVPIIIGSVVGGILLLAILVAV
LYKVGFFKRKRIPQVDETTMTPVAPSEEAPPPSSSS
Download sequence
Identical sequences H9GGK0
ENSACAP00000010387 XP_008119202.1.98722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]